DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Dll

DIOPT Version :10

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_061500243.1 Gene:Dll / 1270045 VectorBaseID:AGAMI1_008705 Length:300 Species:Anopheles gambiae


Alignment Length:112 Identity:24/112 - (21%)
Similarity:43/112 - (38%) Gaps:44/112 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YSLLCYDIIITKLGGSK-------------MFDELDQVLLHLKTDTRIVPTEIIF-CNVINFFGR 95
            |:.|.:.|.:..||.|:             ||.:|:.::|            :|| .|.::.|  
Mosquito    29 YNTLFFFISLFPLGVSRTLLLLSSTEFLWPMFIDLESIVL------------VIFTLNTMSHF-- 79

  Fly    96 GKLPSRALHMFDEMPQYRCQRTVKSLNSLLSALLKCGELEKMKERLS 142
                  .::|. ...||  |.|.|.       |..||:..:::::.|
Mosquito    80 ------VIYML-MSSQY--QNTTKE-------LFLCGDSHQVEQKAS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeodomain 254..310 CDD:459649
DllXP_061500243.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.