DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and Nkx2-5

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_446103.2 Gene:Nkx2-5 / 114109 RGDID:620520 Length:319 Species:Rattus norvegicus


Alignment Length:379 Identity:124/379 - (32%)
Similarity:164/379 - (43%) Gaps:93/379 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPFSVTDILSPIEESYR---------KLELNGNPPS----PFRSNS-SSSSINSPGTLTTSTMAN 164
            |||||.|||: :|:..|         :||....|.|    .|:..: |.....:||.........
  Rat    10 TPFSVKDILN-LEQQQRSLAAGDLSARLEATLAPASCMLAAFKPEAYSGPEAAAPGLAELRAELG 73

  Fly   165 PYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHM 229
            |..      ||...:...||........|.|        ...|.|||.....|.:          
  Rat    74 PAP------SPPKCSPAFPTAPTFYPRAYGD--------PDPAKDPRADKKELCA---------- 114

  Fly   230 GNMSGLAACSVSDSKPLQFPLAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLT 293
              :........:::...:.|.|:||:: ||||:||||||||||||||||||||||:.|||::.||
  Rat   115 --LQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLT 177

  Fly   294 PTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHG 358
            .|||||||||.|||||||.:::.:........||   ||:||||||:|||||.| :|::.:..:|
  Rat   178 STQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPA---RRIAVPVLVRDGKPCLG-DSAAYAPAYG 238

  Fly   359 TNSTSAGNNT------GSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPD--TSSSLLASYG 415
            ....:.|.|.      |.|....|.|...:..|            ||.:..|.  .::|...::|
  Rat   239 VGLNAYGYNAYPYPGYGGAACSPAYSCAAAYPA------------APPAAQPPAAAANSNFVNFG 291

  Fly   416 TVGGSNVAMLQQPCNNTLMSNSLAMAYRNQNNFISNGHQQQCGGYLPLQG-RAW 468
             ||..|.  :|.|                       |..|...|...|.| |||
  Rat   292 -VGDLNT--VQSP-----------------------GMPQGNSGVSTLHGIRAW 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 43/53 (81%)
Nkx2-5NP_446103.2 Homeobox 144..194 CDD:395001 41/49 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.