DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and HOXB13

DIOPT Version :10

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_006352.2 Gene:HOXB13 / 10481 HGNCID:5112 Length:284 Species:Homo sapiens


Alignment Length:66 Identity:23/66 - (34%)
Similarity:41/66 - (62%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 RKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKR-QAKEKAM 317
            ||:|:.:::.|:.||||.:...::::..:|..:::...|:..|:.|||||.|.|.|: .||.|..
Human   217 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVKNS 281

  Fly   318 A 318
            |
Human   282 A 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeodomain 254..310 CDD:459649 18/55 (33%)
HOXB13NP_006352.2 HoxA13_N 12..123 CDD:463521
Homeodomain 217..273 CDD:459649 18/55 (33%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 217..246 8/28 (29%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 258..269 6/10 (60%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 270..273 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.