DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx1-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002937845.1 Gene:nkx1-2 / 100486193 XenbaseID:XB-GENE-854960 Length:246 Species:Xenopus tropicalis


Alignment Length:253 Identity:64/253 - (25%)
Similarity:91/253 - (35%) Gaps:93/253 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QHQSTLFNSNH-STPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSINSPG----TLTTST 161
            |.:.::....| .|||.:||||     ::.|::       ..:..:....:...|    ||.:.:
 Frog     9 QEEKSVPGQKHLHTPFFITDIL-----NHAKVQ-------QVKEGTQEPGMKEKGDTGLTLPSDS 61

  Fly   162 MANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTM 226
            |.:         .|.::....|.:...|.....:.        .|.|.|                
 Frog    62 MVS---------GPEIKAETSPGEPEELPEKEENQ--------ETQNVP---------------- 93

  Fly   227 SHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIH 291
                        ||::.||        |:.|..||..|:..||.||:..||||..||..||..:|
 Frog    94 ------------SVTNCKP--------RRARTAFTYEQLVALESRFRSSRYLSVCERLSLALTLH 138

  Fly   292 LTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNN 349
            ||.|||||||||.|.|.|:|             ||..|          .:|:.||..|
 Frog   139 LTETQVKIWFQNRRTKWKKQ-------------QPIGS----------LEGRGCSIQN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 30/52 (58%)
nkx1-2XP_002937845.1 Homeobox 104..157 CDD:365835 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.