DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2-5

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001116891.1 Gene:nkx2-5 / 100144646 XenbaseID:XB-GENE-487966 Length:300 Species:Xenopus tropicalis


Alignment Length:323 Identity:111/323 - (34%)
Similarity:152/323 - (47%) Gaps:68/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 STPFSVTDILSPIEESYRKLELNGNPPSPF----RSNSSSSSINS------PGTLTTSTMANPYA 167
            ||||||.|||:        ||.:.:..||.    |..:||..:::      |||...|.:....|
 Frog     8 STPFSVKDILN--------LEQHQSGLSPMDITSRLENSSCMLSTFKQEPYPGTPCLSELTEELA 64

  Fly   168 MGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNM 232
            .......|      .|........:|.:|.:|     ....|.:..|..|..     |:.|    
 Frog    65 QRDSSKGP------SPFPGSFFVKNYLEMDSS-----KDPKDDKKDICPLQK-----TLEH---- 109

  Fly   233 SGLAACSVSDSKPLQFP----LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLT 293
                     |.:..:.|    ..:|||.||||:||||||||||||||:|||||||:|||:::.||
 Frog   110 ---------DKREAEDPERPRQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVLKLT 165

  Fly   294 PTQVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQS---- 354
            .|||||||||.|||||||.:::.:....     ...|||:||||||:|||||.|.:|...|    
 Frog   166 STQVKIWFQNRRYKCKRQRQDQTLEMVG-----LPPPRRIAVPVLVRDGKPCLGESSPYNSPYNV 225

  Fly   355 --QQHGTNSTSAGNN------TGSANNGNANSGIVSVTANVSGGLNLITGDAPNSHSPDTSSS 409
              ..:..|:..|.:|      :||.|...::...:..|:..:..:|...||.....:|...:|
 Frog   226 SINPYSYNTYPAYSNYSNPACSGSYNCSYSSMPSMQPTSAGNNFMNFSVGDLNTVQTPIQQAS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 42/52 (81%)
nkx2-5NP_001116891.1 Homeobox 132..182 CDD:365835 40/49 (82%)
COG5576 <133..235 CDD:227863 60/106 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.