DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2-1

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002935383.1 Gene:nkx2-1 / 100135015 XenbaseID:XB-GENE-485985 Length:346 Species:Xenopus tropicalis


Alignment Length:391 Identity:168/391 - (42%)
Similarity:202/391 - (51%) Gaps:85/391 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 HSTPFSVTDILSPIEESYRKLELN----GNPPSPF--RSNSSSSSINSPGTLTTSTMANPYAMGT 170
            |:|||||:|||||:||||:|:.:.    |.|.|..  :|..|.:|:...|      |.:...:..
 Frog     7 HTTPFSVSDILSPLEESYKKVAMESAGLGAPLSAAYRQSQVSQASMQQHG------MGHNGPVSA 65

  Fly   171 LYH--SPGVQT--------YC----GPTDNLSLAGHYTD-MRNSAS--WYGSTANDPRFA-ISRL 217
            .||  :.||..        ||    |...|:|....|.| ||||::  |||:.. ||||: |||.
 Frog    66 AYHMTAAGVPQLSHTTMGGYCNGNLGNLGNMSELPPYQDTMRNSSATGWYGANP-DPRFSTISRF 129

  Fly   218 MSSSASGTMSHMGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPE 282
            |..|:...|..:|||..|.....| ..|||  ...||||||||:||||||||||||||:||||||
 Frog   130 MGPSSGMNMGGLGNMGSLGDVGKS-MTPLQ--ATPRRKRRVLFSQAQVYELERRFKQQKYLSAPE 191

  Fly   283 REHLASLIHLTPTQVKIWFQNHRYKCKRQAKEKAMAEQNQHN----QPASSPRRVAVPVLVKDGK 343
            ||||||:||||||||||||||||||.|||||:||..:|.|.:    |...|||||||||||||||
 Frog   192 REHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQMQQDNSSCQQQQSPRRVAVPVLVKDGK 256

  Fly   344 PC-SGNNS-----SSQSQQHGTNSTSAGNNTGSANNGNANSGIVSVTANVSGGLNLITGDAPNSH 402
            || :|:|:     .|..||..|..|...|..|...:...||      |..|..|      .|:|:
 Frog   257 PCQAGSNTPTAALQSHQQQTATAITVTSNGLGPHQSHQTNS------AGQSPDL------VPHSN 309

  Fly   403 SPDTSSSLLASYGTVGGSNVAMLQQPCNNTLMSNSLAMAYRNQNNFISNGHQQQCGGYLPLQGRA 467
            ||.:                  ||....:....||.:..|         |....|...  |.||.
 Frog   310 SPSS------------------LQNQVTSLSHLNSSSSDY---------GSAMSCSTL--LYGRT 345

  Fly   468 W 468
            |
 Frog   346 W 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 49/52 (94%)
nkx2-1XP_002935383.1 Homeobox 165..219 CDD:365835 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6014
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3379
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002967
OrthoInspector 1 1.000 - - otm49066
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2571
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.