DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2-6

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002932599.1 Gene:nkx2-6 / 100038094 XenbaseID:XB-GENE-486951 Length:254 Species:Xenopus tropicalis


Alignment Length:294 Identity:113/294 - (38%)
Similarity:136/294 - (46%) Gaps:70/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 STPFSVTDILSPIEESYRKLELNGNPPS-PFRSNSSSSSINSPGTLTTSTMANPYAMGTLYHSPG 176
            ||||||.|||        :|| ||...| |.||:        |||       :|..:|.....|.
 Frog     8 STPFSVKDIL--------RLE-NGQVGSAPVRSH--------PGT-------DPLLIGAARRDPI 48

  Fly   177 VQTYCGPTDNLSLAGHYTDMRNSASWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVS 241
            .:....|               .|........||.||            ....|...||......
 Frog    49 ERDRESP---------------GAFCQSPQIEDPDFA------------QEQSGYFGGLGRGGPQ 86

  Fly   242 DSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRY 306
            :    |....||||.||||:|.||:||||||||||||||||||.||..:.||.|||||||||.||
 Frog    87 E----QLHHRQRRKPRVLFSQMQVFELERRFKQQRYLSAPEREQLALALKLTSTQVKIWFQNRRY 147

  Fly   307 KCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNSSSQSQQHGTNSTSAGNNT--- 368
            |||||.:::::  :..|..|   ||||||||||:|||||.|...:..|..    :.||...|   
 Frog   148 KCKRQKQDRSL--ELGHPIP---PRRVAVPVLVRDGKPCLGPTQTFASPY----NVSATPYTYPV 203

  Fly   369 --GSANNGNANSGIVSVTANVSGGLNLITGDAPN 400
              |:..|....||..||....|..:::.|...|:
 Frog   204 CYGNYTNSPYYSGAPSVPTMGSQLISMNTTAVPS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 41/52 (79%)
nkx2-6XP_002932599.1 Homeobox 97..151 CDD:365835 42/53 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.