DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx6-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002937836.1 Gene:nkx6-2 / 100038084 XenbaseID:XB-GENE-484527 Length:281 Species:Xenopus tropicalis


Alignment Length:343 Identity:87/343 - (25%)
Similarity:126/343 - (36%) Gaps:124/343 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LNTNETSTQNTVSTAAAAAVAHHHHNLSSIHHLQNLHSQHQSTLFN---SNHS------------ 113
            ::||..|.....||..||.     ||::.:          ::|||.   .|.|            
 Frog     7 MDTNRQSAFVLSSTPLAAL-----HNMAEM----------KTTLFPYALQNPSFKAPGLSSLSAQ 56

  Fly   114 ----TPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSS--SSINSPGTLTTSTMANPYAMGTLY 172
                ||..::||||             .|......:|::  ||:.....|.|||       |..:
 Frog    57 IPLGTPHGISDILS-------------RPLGATLGSSANLLSSLPRINGLATST-------GMYF 101

  Fly   173 HSPGVQTYCGPTDNLSLAGHYTDMRNSASW----YGSTANDPRFAISRLMSSSASGTMSHMGNMS 233
            :...|..|  |.....|.|     |....|    .||...|||.           |..|..|   
 Frog   102 NPAAVSRY--PKPLAELPG-----RAPIFWPGVMQGSPWRDPRL-----------GCPSQAG--- 145

  Fly   234 GLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVK 298
                 .|.|..      .:::..|..|:..|::.||:.|:|.:||:.|||..||..:.:|.:|||
 Frog   146 -----MVLDKD------GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVK 199

  Fly   299 IWFQNHRYKC-KRQAKEKAMA------------------EQNQHNQPA---SSPRRVAVPVLVKD 341
            :||||.|.|. ||.|.|.|.|                  |.:::|:|.   |...:::  .|:|.
 Frog   200 VWFQNRRTKWRKRHAAEMATAKKKHDSETEKMKESSENEEDDEYNKPLDPNSDDEKIS--RLLKK 262

  Fly   342 GK--------PCSGNNSS 351
            .|        |||.|:.:
 Frog   263 HKSTNLNLLSPCSNNSDT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 24/53 (45%)
nkx6-2XP_002937836.1 Homeobox 157..211 CDD:365835 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.