DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scro and nkx2-2

DIOPT Version :9

Sequence 1:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002939477.1 Gene:nkx2-2 / 100038077 XenbaseID:XB-GENE-482219 Length:271 Species:Xenopus tropicalis


Alignment Length:285 Identity:108/285 - (37%)
Similarity:139/285 - (48%) Gaps:62/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSSI------NSPGTLTTSTMANPYAM 168
            :|..|.|||.|||...:                 :|....||      ::.|:..|.   .|..:
 Frog     4 TNTKTGFSVKDILDLPD-----------------TNDDEGSIAEGADEDTDGSEPTK---KPRGL 48

  Fly   169 GTLYHSPGVQTYCGPTDNLSLAGHYTDMRNS--ASWYGSTANDPRFAISRLMSSSASGTMSHMGN 231
            |   .|| ::|    ..:|.|...:.|..::  ..|. :|....::::....||::....|....
 Frog    49 G---QSP-LET----VQSLPLKSPFYDSSDNPYTRWL-ATTESIQYSLHGFASSNSQQDSSPKSP 104

  Fly   232 MSGLAACSVSDSKPLQFP-LAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPT 295
            .........:|..|...| ..::|||||||::||.|||||||:|||||||||||||||||.||||
 Frog   105 EPSADESPDNDKDPSTNPDSGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPT 169

  Fly   296 QVKIWFQNHRYKCKRQAKEKAMAEQNQHNQPASSPRRVAVPVLVKDGKPCSGNNS---------- 350
            ||||||||||||.||     |.||:.....|..|||||||||||:|||||....:          
 Frog   170 QVKIWFQNHRYKMKR-----ARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHTLKAQDLAATFPAG 229

  Fly   351 ------SSQSQQH---GTNSTSAGN 366
                  |:||.||   ....:||.|
 Frog   230 IPFSAYSAQSLQHMQYNAQYSSASN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scroNP_001015473.1 Homeobox 256..309 CDD:278475 47/52 (90%)
nkx2-2XP_002939477.1 LAP1C 21..>149 CDD:368520 37/139 (27%)
COG5576 93..216 CDD:227863 76/127 (60%)
Homeobox 130..184 CDD:365835 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.