DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL38 and RPL38

DIOPT Version :9

Sequence 1:NP_001036440.1 Gene:RpL38 / 3355144 FlyBaseID:FBgn0040007 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_013429.1 Gene:RPL38 / 851035 SGDID:S000004317 Length:78 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:34/78 - (43%)
Similarity:44/78 - (56%) Gaps:9/78 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPREIKEVKDFLNKARRSDARAVKIKKNP---------TNTKFKIRCSRFLYTLVVQDKEKADKI 56
            |.|||.::|.||...||:|.:...:|.|.         ..||||:|.|..|||||:.|..||.|:
Yeast     1 MAREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSLYTLVINDAGKAKKL 65

  Fly    57 KQSLPPGLQVKEV 69
            .|||||.|:|..:
Yeast    66 IQSLPPTLKVNRL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL38NP_001036440.1 Ribosomal_L38e 2..68 CDD:396375 33/74 (45%)
RPL38NP_013429.1 Ribosomal_L38e 3..75 CDD:396375 32/71 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344737
Domainoid 1 1.000 59 1.000 Domainoid score I2608
eggNOG 1 0.900 - - E1_KOG3499
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I1776
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53929
OrthoFinder 1 1.000 - - FOG0001834
OrthoInspector 1 1.000 - - oto99157
orthoMCL 1 0.900 - - OOG6_101624
Panther 1 1.100 - - LDO PTHR10965
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1134
SonicParanoid 1 1.000 - - X1359
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.