powered by:
Protein Alignment RpL38 and LOC686066
DIOPT Version :9
Sequence 1: | NP_001036440.1 |
Gene: | RpL38 / 3355144 |
FlyBaseID: | FBgn0040007 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038962709.1 |
Gene: | LOC686066 / 686066 |
RGDID: | 1586630 |
Length: | 68 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 47/70 - (67%) |
Similarity: | 57/70 - (81%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQ 65
|||:|:|:||||..||:.||.:||||||..|.|||:.|||:|||||:.|.|| |:||||||||.
Rat 1 MPRKIEEIKDFLLTARQKDATSVKIKKNKGNVKFKVHCSRYLYTLVITDNEK--KMKQSLPPGLA 63
Fly 66 VKEVK 70
|||:|
Rat 64 VKELK 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166345511 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.