DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL38 and LOC686066

DIOPT Version :9

Sequence 1:NP_001036440.1 Gene:RpL38 / 3355144 FlyBaseID:FBgn0040007 Length:70 Species:Drosophila melanogaster
Sequence 2:XP_038962709.1 Gene:LOC686066 / 686066 RGDID:1586630 Length:68 Species:Rattus norvegicus


Alignment Length:70 Identity:47/70 - (67%)
Similarity:57/70 - (81%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQ 65
            |||:|:|:||||..||:.||.:||||||..|.|||:.|||:|||||:.|.||  |:||||||||.
  Rat     1 MPRKIEEIKDFLLTARQKDATSVKIKKNKGNVKFKVHCSRYLYTLVITDNEK--KMKQSLPPGLA 63

  Fly    66 VKEVK 70
            |||:|
  Rat    64 VKELK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL38NP_001036440.1 Ribosomal_L38e 2..68 CDD:396375 43/65 (66%)
LOC686066XP_038962709.1 Ribosomal_L38e 2..66 CDD:396375 43/65 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.