DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL38 and LOC680353

DIOPT Version :9

Sequence 1:NP_001036440.1 Gene:RpL38 / 3355144 FlyBaseID:FBgn0040007 Length:70 Species:Drosophila melanogaster
Sequence 2:XP_038956429.1 Gene:LOC680353 / 680353 RGDID:1592976 Length:70 Species:Rattus norvegicus


Alignment Length:70 Identity:49/70 - (70%)
Similarity:62/70 - (88%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQ 65
            ||::|:|:||||..|:|.||::||||||..|.|||:||||:|||||:.|||||:|:||||||||.
  Rat     1 MPQKIEEIKDFLLTAQRKDAKSVKIKKNTDNVKFKVRCSRYLYTLVITDKEKAEKLKQSLPPGLA 65

  Fly    66 VKEVK 70
            |||:|
  Rat    66 VKELK 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL38NP_001036440.1 Ribosomal_L38e 2..68 CDD:396375 45/65 (69%)
LOC680353XP_038956429.1 Ribosomal_L38e 2..68 CDD:396375 45/65 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345510
Domainoid 1 1.000 106 1.000 Domainoid score I6431
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4790
OMA 1 1.010 - - QHG53929
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001834
OrthoInspector 1 1.000 - - otm44724
orthoMCL 1 0.900 - - OOG6_101624
Panther 1 1.100 - - O PTHR10965
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1359
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.