DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL38 and rpl38

DIOPT Version :9

Sequence 1:NP_001036440.1 Gene:RpL38 / 3355144 FlyBaseID:FBgn0040007 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_001005094.1 Gene:rpl38 / 448672 XenbaseID:XB-GENE-967893 Length:70 Species:Xenopus tropicalis


Alignment Length:70 Identity:50/70 - (71%)
Similarity:62/70 - (88%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQ 65
            |||:|:|:||||..|||.||::||||||..|.|||:|||::|||||:.|||||:|:||||||||.
 Frog     1 MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSKYLYTLVITDKEKAEKLKQSLPPGLS 65

  Fly    66 VKEVK 70
            |||:|
 Frog    66 VKELK 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL38NP_001036440.1 Ribosomal_L38e 2..68 CDD:396375 46/65 (71%)
rpl38NP_001005094.1 Ribosomal_L38e 2..68 CDD:396375 46/65 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7088
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H87098
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619070at2759
OrthoFinder 1 1.000 - - FOG0001834
OrthoInspector 1 1.000 - - oto102687
Panther 1 1.100 - - LDO PTHR10965
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1134
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.140

Return to query results.
Submit another query.