powered by:
Protein Alignment RpL38 and rpl38
DIOPT Version :9
Sequence 1: | NP_001036440.1 |
Gene: | RpL38 / 3355144 |
FlyBaseID: | FBgn0040007 |
Length: | 70 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005094.1 |
Gene: | rpl38 / 448672 |
XenbaseID: | XB-GENE-967893 |
Length: | 70 |
Species: | Xenopus tropicalis |
Alignment Length: | 70 |
Identity: | 50/70 - (71%) |
Similarity: | 62/70 - (88%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQ 65
|||:|:|:||||..|||.||::||||||..|.|||:|||::|||||:.|||||:|:||||||||.
Frog 1 MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSKYLYTLVITDKEKAEKLKQSLPPGLS 65
Fly 66 VKEVK 70
|||:|
Frog 66 VKELK 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
98 |
1.000 |
Domainoid score |
I7088 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H87098 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1619070at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001834 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto102687 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10965 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1134 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 7.140 |
|
Return to query results.
Submit another query.