DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL38 and rpl3802

DIOPT Version :9

Sequence 1:NP_001036440.1 Gene:RpL38 / 3355144 FlyBaseID:FBgn0040007 Length:70 Species:Drosophila melanogaster
Sequence 2:NP_593205.1 Gene:rpl3802 / 2541705 PomBaseID:SPAC30D11.12 Length:74 Species:Schizosaccharomyces pombe


Alignment Length:70 Identity:39/70 - (55%)
Similarity:52/70 - (74%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPREIKEVKDFLNKARRSDARAVKIKKNPTN-TKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGL 64
            |||::.::|.||..|.|.||.:.::|||... .|||:||||:||||||.|.:||:|::|||||.|
pombe     1 MPRQVTDIKLFLQLAHRGDATSARVKKNQNKAVKFKLRCSRYLYTLVVADAKKAEKLRQSLPPAL 65

  Fly    65 QVKEV 69
            .|.||
pombe    66 TVTEV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL38NP_001036440.1 Ribosomal_L38e 2..68 CDD:396375 36/66 (55%)
rpl3802NP_593205.1 Ribosomal_L38e 2..69 CDD:280033 36/66 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 83 1.000 Domainoid score I2249
eggNOG 1 0.900 - - E1_KOG3499
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I1797
OMA 1 1.010 - - QHG53929
OrthoFinder 1 1.000 - - FOG0001834
OrthoInspector 1 1.000 - - otm47059
orthoMCL 1 0.900 - - OOG6_101624
Panther 1 1.100 - - O PTHR10965
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1134
SonicParanoid 1 1.000 - - X1359
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.