DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p120ctn and Armc2

DIOPT Version :9

Sequence 1:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster
Sequence 2:XP_574794.3 Gene:Armc2 / 499470 RGDID:1562413 Length:895 Species:Rattus norvegicus


Alignment Length:549 Identity:103/549 - (18%)
Similarity:182/549 - (33%) Gaps:195/549 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 ENDICSTMRWRDPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLS 277
            :||   |:..:|..|..::..|.:..  :::|..|:|..:..:        :.:.|.|      .
  Rat   398 KND---TLMQKDNILQSLLEVLRDED--LQSNTEAFLYCMGAL--------KFISGSP------G 443

  Fly   278 YDSPEIHKNACGALRNLSYGRQNDENKRG--IKNAGGIAALVHLLCRSQETEVKELVTGVLWNMS 340
            :.:..::|.....|..|......|..|.|  :.|:|      |||.::         |..|.|:.
  Rat   444 FLTEMVNKGTVEILVQLIKETTEDTEKHGACLPNSG------HLLVQT---------TATLRNLV 493

  Fly   341 SCEDLKRSIIDEALVAVVCSVIKPHSGWDAVCCGETCFSTVFRNASGVLRNVSSAGEHARGCLRN 405
            .....:..:::......:|:|:..|.....:|          .|.:.|...::|    .|.|   
  Rat   494 DSPLTRSKLLNIGAFPCLCTVMGQHMNDKDIC----------TNIARVFSKLTS----YRDC--- 541

  Fly   406 CEHLVE-----CLLYVVRTSIEKNN---------IGNKT----------------VENCVCILRN 440
            |..||.     .|...:....:||.         :||.|                ||..:.:.:|
  Rat   542 CAALVSYSRCYALFLSLLNKYQKNQDLVIRIVFILGNLTAKSNQARELFSGESGSVETLLTLFQN 606

  Fly   441 LSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNSDALNEYN--------- 496
            . ||.:|                   ||.|.:..|.      :..|...|.|.:..         
  Rat   607 F-YRLEE-------------------SSPKLQRSGA------RPRAEAEDVLVKLTRVLANIAIH 645

  Fly   497 ------ISADYSKSSVTYNKLNKGYEQLWQPEVVQYYLSLLQSCSNPETLEA---AAGAIQNLSA 552
                  ::||                    |.||...|:.|:|.|..:..|.   ...||.||| 
  Rat   646 PCIGPVLAAD--------------------PRVVGLLLTTLESKSLGDCEELVINTTAAINNLS- 689

  Fly   553 CYWQPSIDIRATVRKEKGLPILVELLRMEVDRVVCAVATALR---NLAIDQRNKELIGKYAMRDL 614
             ::|    ::::|.:.:.|.:...||::.|...:..:..|:|   ||:.|            .|:
  Rat   690 -FYQ----VKSSVLQHRKLYVAELLLKLLVSNNMDGILEAVRVFGNLSQD------------HDV 737

  Fly   615 VQKLPSGNVQH------DQNTSDDTITAVLATINEVIKKNPEFSRSLL-DSGGIDRLMNITKRKE 672
            ...|...||..      :....|...:|....:|..:.|:   .|::| :.|||.:|::      
  Rat   738 CNFLMQKNVHKFLITLLEAKHQDICFSACGVLLNLTVDKD---KRAVLKEGGGIKKLVD------ 793

  Fly   673 KYTSCVLKF-------ASQVLYTMWQHNE 694
                |:..|       |..|..|:|..:|
  Rat   794 ----CLRDFGPGDWQLACLVCKTLWNFSE 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 21/115 (18%)
armadillo repeat 227..252 CDD:293788 5/24 (21%)
armadillo repeat 260..296 CDD:293788 5/35 (14%)
armadillo repeat 304..339 CDD:293788 9/36 (25%)
ARM 307..442 CDD:237987 29/164 (18%)
armadillo repeat 347..392 CDD:293788 6/44 (14%)
armadillo repeat 515..556 CDD:293788 13/43 (30%)
ARM 516..643 CDD:237987 30/138 (22%)
armadillo repeat 562..596 CDD:293788 7/36 (19%)
armadillo repeat 601..641 CDD:293788 6/45 (13%)
Armc2XP_574794.3 ARM 402..537 CDD:237987 28/175 (16%)
armadillo repeat 656..688 CDD:293788 10/31 (32%)
ARM 698..818 CDD:237987 29/144 (20%)
armadillo repeat 734..774 CDD:293788 8/51 (16%)
armadillo repeat 779..815 CDD:293788 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.