DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p120ctn and arm

DIOPT Version :9

Sequence 1:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster


Alignment Length:748 Identity:146/748 - (19%)
Similarity:245/748 - (32%) Gaps:266/748 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GAITKVAPHCSQNKIE----------------TNSTDNSIPDIENHPLATTVRYVQAGQYEDTSE 113
            ||:|:| |..|..:.|                .|.|.:.:.|:......|..:.|:|..:.:|.|
  Fly    49 GAVTQV-PSLSGKEDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLE 112

  Fly   114 YGVAGLTCGID-------------SEYTAEAVVPYC-YTSDANYTGIQNTTSSIKPFSGRPFNDN 164
            .|:...:...|             |:....|||... |..||     :..|.:| |...:..||.
  Fly   113 EGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDA-----ELATRAI-PELIKLLNDE 171

  Fly   165 INGAEAVADSQCRTFKSSAEFKLPQFAMSSINTVPQRLEEKDDYIEGSENDICSTMR-------- 221
                :.|..||..........|  :.:..:|...||.:......|..| ||:.||..        
  Fly   172 ----DQVVVSQAAMMVHQLSKK--EASRHAIMNSPQMVAALVRAISNS-NDLESTKAAVGTLHNL 229

  Fly   222 ----------WRDPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLL 276
                      ::...:..::..||:|..::...|...|.:|....|.:|...|..||:..:|.||
  Fly   230 SHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLL 294

  Fly   277 SYDSPEIHKNACGALRNLSYGRQNDE--------------------------------------- 302
            ..::.:........|:.|:||.|..:                                       
  Fly   295 QRNNVKFLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCS 359

  Fly   303 -NKRGIKNAGGIAAL-VHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPH 365
             ||..|.:|||:.|| :||...|     ..||...||.:.:..|....:  |.|.|::.|:::..
  Fly   360 SNKPAIVDAGGMQALAMHLGNMS-----PRLVQNCLWTLRNLSDAATKV--EGLEALLQSLVQVL 417

  Fly   366 SGWD--AVCCGETCFSTVFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGN 428
            ...|  .|.|           |:|:|.|::...:..:..:  |:  |..:..:|||.|   |.|:
  Fly   418 GSTDVNVVTC-----------AAGILSNLTCNNQRNKATV--CQ--VGGVDALVRTII---NAGD 464

  Fly   429 K--TVENCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNSDA 491
            :  ..|..||.||:|:.|                                               
  Fly   465 REEITEPAVCALRHLTSR----------------------------------------------- 482

  Fly   492 LNEYNISADYSKSSVTYNKLNKGYEQLWQPEVVQYYLSLLQSCSNPETLEAAAGAIQNLSAC--- 553
                ::.::.::::|   :||.|         :...:.||...|....::|..|.|:||:.|   
  Fly   483 ----HVDSELAQNAV---RLNYG---------LSVIVKLLHPPSRWPLIKAVIGLIRNLALCPAN 531

  Fly   554 -----------------------------------YWQPS------------------IDI---- 561
                                               ..|||                  :.|    
  Fly   532 HAPLREHGAIHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARE 596

  Fly   562 ---RATVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNV 623
               ||.:|::..:||.|.||..|::.:....|..|..||.|:...|:|.:.....     |..::
  Fly   597 SHNRALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATG-----PLTDL 656

  Fly   624 QHDQNTSDDT-ITAVLATINEVIKKNPEFSRSL 655
            .|.:|....| ..|||..::|  .|..::.:.|
  Fly   657 LHSRNEGVATYAAAVLFRMSE--DKPQDYKKRL 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 34/154 (22%)
armadillo repeat 227..252 CDD:293788 5/24 (21%)
armadillo repeat 260..296 CDD:293788 9/35 (26%)
armadillo repeat 304..339 CDD:293788 14/35 (40%)
ARM 307..442 CDD:237987 38/139 (27%)
armadillo repeat 347..392 CDD:293788 10/46 (22%)
armadillo repeat 515..556 CDD:293788 9/78 (12%)
ARM 516..643 CDD:237987 36/190 (19%)
armadillo repeat 562..596 CDD:293788 11/33 (33%)
armadillo repeat 601..641 CDD:293788 9/40 (23%)
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 37/176 (21%)
armadillo repeat 161..186 CDD:293788 7/29 (24%)
armadillo repeat 193..231 CDD:293788 9/38 (24%)
armadillo repeat 238..270 CDD:293788 5/31 (16%)
armadillo repeat 278..314 CDD:293788 9/35 (26%)
armadillo repeat 320..355 CDD:293788 0/34 (0%)
Arm 361..398 CDD:278915 15/41 (37%)
armadillo repeat 362..397 CDD:293788 14/39 (36%)
armadillo repeat 410..435 CDD:293788 7/35 (20%)
Arm 439..481 CDD:278915 14/48 (29%)
armadillo repeat 443..481 CDD:293788 14/44 (32%)
armadillo repeat 490..525 CDD:293788 10/46 (22%)
Arm 597..636 CDD:278915 12/38 (32%)
armadillo repeat 600..636 CDD:293788 12/35 (34%)
armadillo repeat 641..675 CDD:293788 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.