DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p120ctn and CTNNB1

DIOPT Version :9

Sequence 1:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_001091679.1 Gene:CTNNB1 / 1499 HGNCID:2514 Length:781 Species:Homo sapiens


Alignment Length:837 Identity:169/837 - (20%)
Similarity:288/837 - (34%) Gaps:259/837 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MDLSLTHEPANMQSQFGSFQNYDQFSAAGYSSTPLYITKPTGVGAITKVAPHCS------QNKIE 80
            |:|.:..||             |:.:|..:.....|:......|| |..||..|      :..::
Human     8 MELDMAMEP-------------DRKAAVSHWQQQSYLDSGIHSGA-TTTAPSLSGKGNPEEEDVD 58

  Fly    81 TNS-------------TDNSIPDIENHPLATTVRYVQAGQYEDTSEYGVAGLTCGIDSEYTAEA- 131
            |:.             |...:.||:.....|..:.|:|..:.:|.:.|:...:...|:.:.... 
Human    59 TSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQ 123

  Fly   132 -------VVPYCYTSDANYTGIQNTTSSIKPFSGRPFNDN----INGAEAVADSQCRTFKSS--A 183
                   ::.:...:..||.......:...|...:..||.    :|.| ||...|....::|  |
Human   124 RLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKA-AVMVHQLSKKEASRHA 187

  Fly   184 EFKLPQFAMSSINTVPQRLEEKDDYIEGSENDICSTMR-------------------WRDPNLSE 229
            ..:.||...:.:.|:.            :.||: .|.|                   ::...:..
Human   188 IMRSPQMVSAIVRTMQ------------NTNDV-ETARCTAGTLHNLSHHREGLLAIFKSGGIPA 239

  Fly   230 VISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALRNL 294
            ::..|.:|..::...|...|.:|....:..|...|..||:..:|.||:..:.:........|:.|
Human   240 LVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQIL 304

  Fly   295 SYGRQNDENKRGIKNAGGIAALVHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVC 359
            :||  |.|:|..|..:||..|||::: |:...|      .:||..|..  ||        |..||
Human   305 AYG--NQESKLIILASGGPQALVNIM-RTYTYE------KLLWTTSRV--LK--------VLSVC 350

  Fly   360 SVIKP----HSGWDAVCCGETCFS-TVFRNASGVLRNVSSAG---EHARGCLRNCEHL------- 409
            |..||    ..|..|:....|..| .:.:|....|||:|.|.   |...|.|.....|       
Human   351 SSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDIN 415

  Fly   410 -VECLLYVVRTSIEKNNIGNKTV------------------------ENCVCILRNLSYRCQEVD 449
             |.|...:: :::..||..||.:                        |..:|.||:|:.|.||  
Human   416 VVTCAAGIL-SNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQE-- 477

  Fly   450 DPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNSDALNEYNISADYSKSSVTYNKLNKG 514
                                                             |:.::::|   :|:.|
Human   478 -------------------------------------------------AEMAQNAV---RLHYG 490

  Fly   515 YEQLWQPEVVQYYLSLLQSCSNPETLEAAAGAIQNLSACYWQPSIDIRATVRKEKGLPILVELL- 578
            .     |.||:    ||...|:...::|..|.|:||:.|   |:  ..|.:|::..:|.||:|| 
Human   491 L-----PVVVK----LLHPPSHWPLIKATVGLIRNLALC---PA--NHAPLREQGAIPRLVQLLV 541

  Fly   579 -----------------------RMEVDRVVCAVATALRNLAIDQRNKELI-GKYAMRDLVQKL- 618
                                   |||  .:|.....||..||.|..|:.:| |...:...||.| 
Human   542 RAHQDTQRRTSMGGTQQQFVEGVRME--EIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLY 604

  Fly   619 -PSGNVQHDQNTSDDTITAVLATINEVIKKNPEFSRSLLDSGGIDRLMNITKRKEKYTSCVLKFA 682
             |..|:|.           |.|.:...:.::.|.:.::...|....|..:...:.:   .|..:|
Human   605 SPIENIQR-----------VAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNE---GVATYA 655

  Fly   683 SQVLYTMWQHNELRDVYKKNGWKEQDFVSKHFTAHNTPPSSPNNVNNTLNRPMASQG 739
            :.||:.|.:.       |...:|::..|....:...|.|.:.|...: |...:.:||
Human   656 AAVLFRMSED-------KPQDYKKRLSVELTSSLFRTEPMAWNETAD-LGLDIGAQG 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 29/113 (26%)
armadillo repeat 227..252 CDD:293788 4/24 (17%)
armadillo repeat 260..296 CDD:293788 9/35 (26%)
armadillo repeat 304..339 CDD:293788 11/34 (32%)
ARM 307..442 CDD:237987 43/174 (25%)
armadillo repeat 347..392 CDD:293788 13/49 (27%)
armadillo repeat 515..556 CDD:293788 12/40 (30%)
ARM 516..643 CDD:237987 40/153 (26%)
armadillo repeat 562..596 CDD:293788 13/57 (23%)
armadillo repeat 601..641 CDD:293788 11/42 (26%)
CTNNB1NP_001091679.1 Interaction with VCL. /evidence=ECO:0000250 2..23 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..57 6/23 (26%)
SRP1 142..>431 CDD:227396 72/322 (22%)
ARM 1 151..191 10/40 (25%)
armadillo repeat 153..178 CDD:293788 7/25 (28%)
Interaction with BCL9. /evidence=ECO:0000269|PubMed:17052462 156..178 6/22 (27%)
armadillo repeat 188..221 CDD:293788 7/45 (16%)
ARM 2 193..234 6/53 (11%)
armadillo repeat 230..262 CDD:293788 4/31 (13%)
ARM 230..262 CDD:214547 4/31 (13%)
ARM 3 235..276 7/40 (18%)
armadillo repeat 270..306 CDD:293788 9/35 (26%)
ARM 4 277..318 13/42 (31%)
armadillo repeat 312..347 CDD:293788 14/51 (27%)
ARM 5 319..360 18/57 (32%)
ARM 350..390 CDD:214547 12/39 (31%)
armadillo repeat 354..389 CDD:293788 10/34 (29%)
ARM 6 361..389 8/27 (30%)
ARM 7 400..441 9/41 (22%)
armadillo repeat 402..427 CDD:293788 4/25 (16%)
Arm 431..473 CDD:395413 8/41 (20%)
armadillo repeat 435..473 CDD:293788 6/37 (16%)
ARM 8 442..484 9/92 (10%)
armadillo repeat 482..517 CDD:293788 12/46 (26%)
ARM 9 489..530 16/54 (30%)
armadillo repeat 524..582 CDD:293788 14/59 (24%)
ARM 10 531..571 8/41 (20%)
Arm 583..622 CDD:395413 12/49 (24%)
armadillo repeat 587..621 CDD:293788 10/44 (23%)
ARM 11 594..636 9/52 (17%)
armadillo repeat 629..662 CDD:293788 6/35 (17%)
ARM 12 637..666 6/38 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..781 169/837 (20%)
Interaction with SCRIB. /evidence=ECO:0000250 772..781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.