DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17883 and Tbc1d20

DIOPT Version :9

Sequence 1:NP_001036448.1 Gene:CG17883 / 3355139 FlyBaseID:FBgn0040005 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_077158.1 Gene:Tbc1d20 / 67231 MGIID:1914481 Length:402 Species:Mus musculus


Alignment Length:295 Identity:129/295 - (43%)
Similarity:187/295 - (63%) Gaps:6/295 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTLDKFQC 86
            ||..||.:.:|.:   .|....|.:::::..||:.|:.|..:||:|..|:.:........|....
Mouse    30 KKVAEIHQALNSD---PIDLAALRRMAISEGGLLTDEIRCQVWPKLLNVNTSEPPPVSRKDLRDM 91

  Fly    87 HPEYNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQGYHDVAVTFLLVV 151
            ..:|.||:|||.|||:|||||:|.|||..||::|..:||.|:.:.|.|.|||||||:.|||||||
Mouse    92 SKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDIILLVLDRNPQLHYYQGYHDIVVTFLLVV 156

  Fly   152 GEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELYQFLQNSTVGTLFSLPWYL 216
            ||.:|.:::|:|||.|..:.|..||:.|:..|.::.|||...:|||:.|:|::.|||:|:|.|.:
Mouse   157 GERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVSPELHDFMQSAEVGTIFALSWLI 221

  Fly   217 TWFGHSLTSYRTVVRLYDYFLASPIYTSIFVTAAILLYRSDEILKEDCDMASVHCLLSVIPEDLP 281
            |||||.|..:|.||||||:|||......|:..|.|:|||..|:|..||||||||.|||.||:|||
Mouse   222 TWFGHVLMDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLP 286

  Fly   282 FEDLLKTSSSLLNKYSLTLIEKDVEELICQERRKR 316
            :|.|:..:..|..::..:.:.:   |...|:..:|
Mouse   287 YETLISRAGDLFVQFPPSELAR---EAAAQQEAER 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17883NP_001036448.1 RabGAP-TBC 91..260 CDD:278964 89/168 (53%)
Tbc1d20NP_077158.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
RabGAP-TBC 62..265 CDD:278964 97/202 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850236
Domainoid 1 1.000 195 1.000 Domainoid score I3151
eggNOG 1 0.900 - - E1_KOG2595
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32574
Inparanoid 1 1.050 247 1.000 Inparanoid score I3253
Isobase 1 0.950 - 0 Normalized mean entropy S3290
OMA 1 1.010 - - QHG54480
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003660
OrthoInspector 1 1.000 - - oto94963
orthoMCL 1 0.900 - - OOG6_103152
Panther 1 1.100 - - O PTHR20913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R538
SonicParanoid 1 1.000 - - X2532
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.