DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17883 and TBC1D20

DIOPT Version :9

Sequence 1:NP_001036448.1 Gene:CG17883 / 3355139 FlyBaseID:FBgn0040005 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_653229.1 Gene:TBC1D20 / 128637 HGNCID:16133 Length:403 Species:Homo sapiens


Alignment Length:307 Identity:134/307 - (43%)
Similarity:196/307 - (63%) Gaps:10/307 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EKCPESDDELKKRLEIEKLINKNIDKNISFDV--LVKLSLAPYGLVNDDFRRILWPQLAGVDINH 74
            ||...:....||..||.:.:|.:     ..||  |.:::::..||:.|:.||.:||:|..|:.|.
Human    21 EKADFNAKRKKKVAEIHQALNSD-----PTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNAND 80

  Fly    75 LGQAPTLDKFQCHPEYNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQG 139
            .......:..|...:|.||:|||.|||:|||||:|.|||..||::|..:||.::::.|.|.||||
Human    81 PPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQG 145

  Fly   140 YHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELYQFLQNS 204
            |||:.|||||||||.:|.:::|:|||.|..:.|..||:.|:..|.::.|||...||||:.|:|::
Human   146 YHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSA 210

  Fly   205 TVGTLFSLPWYLTWFGHSLTSYRTVVRLYDYFLASPIYTSIFVTAAILLYRSDEILKEDCDMASV 269
            .|||:|:|.|.:|||||.|:.:|.||||||:|||......|:..|.|:|||..|:|..|||||||
Human   211 EVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASV 275

  Fly   270 HCLLSVIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERRKR 316
            |.|||.||:|||:|.|:..:..|..::..:.:.:   |...|::.:|
Human   276 HHLLSQIPQDLPYETLISRAGDLFVQFPPSELAR---EAAAQQQAER 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17883NP_001036448.1 RabGAP-TBC 91..260 CDD:278964 89/168 (53%)
TBC1D20NP_653229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 2/3 (67%)
RabGAP-TBC 63..266 CDD:306939 99/202 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159867
Domainoid 1 1.000 203 1.000 Domainoid score I2984
eggNOG 1 0.900 - - E1_KOG2595
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32574
Inparanoid 1 1.050 253 1.000 Inparanoid score I3219
Isobase 1 0.950 - 0 Normalized mean entropy S3290
OMA 1 1.010 - - QHG54480
OrthoDB 1 1.010 - - D1107565at2759
OrthoFinder 1 1.000 - - FOG0003660
OrthoInspector 1 1.000 - - oto91382
orthoMCL 1 0.900 - - OOG6_103152
Panther 1 1.100 - - O PTHR20913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R538
SonicParanoid 1 1.000 - - X2532
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.