DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17486 and ASNS

DIOPT Version :9

Sequence 1:NP_001036446.2 Gene:CG17486 / 3355138 FlyBaseID:FBgn0032997 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001339425.1 Gene:ASNS / 440 HGNCID:753 Length:561 Species:Homo sapiens


Alignment Length:611 Identity:134/611 - (21%)
Similarity:224/611 - (36%) Gaps:164/611 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGIFCSVVNNVPLNSFNISSALKVILKNRGPDV-QDEVVIDY---CFG--KILFAGFVLWQQGE 59
            ||||: ::..:....|....||:|:  .:||||. :.|.|..|   |||  ::.....:...|..
Human     1 MCGIW-ALFGSDDCLSVQCLSAMKI--AHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPI 62

  Fly    60 SVQKQPVVEDDFIFL-FNGDIYNTSKP----EYMSDTTWIAERLAECRCK---EQNILKILKRLE 116
            .|:|.|     :::| :||:|||..|.    |:...|....|.:.....|   ||.|.    .|:
Human    63 RVKKYP-----YLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTIC----MLD 118

  Fly   117 GPHCLIIYDKREQILYFSRDALGRNSLLIERICNGFQLLSTSHFEDKKISLELPPLGLFRVKLND 181
            |....::.|...:.::..||..|...|        |:.::    ||..:::.....||..:|.:.
Human   119 GVFAFVLLDTANKKVFLGRDTYGVRPL--------FKAMT----EDGFLAVCSEAKGLVTLKHSA 171

  Fly   182 LNSCVLYPWQPLNNYSTQLLRNLDLAIGWKTAVESPMS-------PDWMLNCNPAFSYNFYEFQY 239
            .....:.|:.| .:|..     |||....|.|....:.       |...|..|....:..:|.:.
Human   172 TPFLKVEPFLP-GHYEV-----LDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIET 230

  Fly   240 IKNNVNLYKNLIDQSEIKYTLSILHTLLSDSIKNRVRNMAPFCRLCMQKLNISPPCRHAKLCILF 304
            :|||                   |..|.::::|.|:..                   ..::..|.
Human   231 VKNN-------------------LRILFNNAVKKRLMT-------------------DRRIGCLL 257

  Fly   305 SGGLDCTIL-ALLANQF--VPVNEPIELINVAFESVKGQNISEKLFDVPD----RKTS------- 355
            |||||.::: |.|..|.  ..|..|::...:..|            |.||    ||.:       
Human   258 SGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGME------------DSPDLLAARKVADHIGSEH 310

  Fly   356 ---LVSVNELKQLCPERCWNLLKVNVT--RLELQQHLTSRIKHLIYPLDTVLDESLGCAFWFASH 415
               |.:..|..|...|..::|...::|  |..:..:|.|  |::....|:|              
Human   311 YEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLIS--KYIRKNTDSV-------------- 359

  Fly   416 CTHSTARVALIGSGADELFGGYTRYRNSYSRCLGNDLERQLAVQNELERDWQRISARNLARDDRI 480
                   |...|.|:|||..||..:..:.|.      |:   .:.|.||..:.:...::.|.||.
Human   360 -------VIFSGEGSDELTQGYIYFHKAPSP------EK---AEEESERLLRELYLFDVLRADRT 408

  Fly   481 IADTGKTARSPFIEENFVKFIRSLEVYQKCCFGFPEGVGDKLLLRLYGYQIGL--RDVVFLKKRA 543
            .|..|...|.||::..|..:..||....:    .|:...:|.|||.......|  :::::..|.|
Human   409 TAAHGLELRVPFLDHRFSSYYLSLPPEMR----IPKNGIEKHLLRETFEDSNLIPKEILWRPKEA 469

  Fly   544 IQFG-SRIANK-----KQNGSHQSDN 563
            ...| :.:.|.     ::...||.|:
Human   470 FSDGITSVKNSWFKILQEYVEHQVDD 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17486NP_001036446.2 Gn_AT_II_novel 1..175 CDD:239735 47/187 (25%)
Asn_Synthase_B_C 266..547 CDD:238949 64/301 (21%)
ASNSNP_001339425.1 asnB 1..555 CDD:236513 134/611 (22%)
Glutamine binding. /evidence=ECO:0000250 49..53 0/3 (0%)
Glutamine binding. /evidence=ECO:0000250 75..77 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0367
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.