DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17486 and AsnS

DIOPT Version :9

Sequence 1:NP_001036446.2 Gene:CG17486 / 3355138 FlyBaseID:FBgn0032997 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_996132.1 Gene:AsnS / 2768965 FlyBaseID:FBgn0270926 Length:558 Species:Drosophila melanogaster


Alignment Length:643 Identity:126/643 - (19%)
Similarity:224/643 - (34%) Gaps:234/643 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCGIFCSVVNN---VPLNSFNISS-ALKVIL-------KNRGPDVQDEVVIDYCFG--------K 46
            |||||.....:   :|....:.|. :|:.:.       ::|||| ...|.::...|        :
  Fly     1 MCGIFAIFSRDGEPIPTQILHGSKHSLRELAYRQSGKHRHRGPD-STGVYVNSLEGVAMIHERLR 64

  Fly    47 ILFAGFVLWQQGESVQKQPVVEDD--FIFLFNGDIYNTSKPEYMSDTTWIAER------LAECRC 103
            |:         |..:..||.|.:|  .|.:.||:|||     |:..:..||::      :::|..
  Fly    65 II---------GVEMGDQPFVSEDGNLILVANGEIYN-----YLELSAEIAKKRGSYNPMSDCHV 115

  Fly   104 KEQNILK--------ILKRLEGPHCLIIYDKREQILYFSRDALGRNSLLIERICNGFQLLSTSHF 160
                ||:        :|:.:.|.....:||::.:.:..:||..|...:.:....:| .|...|..
  Fly   116 ----ILELYQDYGKDLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASG-NLWVASEM 175

  Fly   161 E-----DKKISLELPPLGLFRVKLNDLNSCVLYPWQPLNNYSTQLLRNLDLAIGWKTAVESPMSP 220
            :     ..|:....|....|. |:.|..:|    ||                             
  Fly   176 KCLVDTCSKVETFTPGEARFG-KVGDFKTC----WQ----------------------------- 206

  Fly   221 DWMLNCNPAFSYNFYEFQYIKNNVNLYKNLIDQSEIKYT------LSILHTLLSDSIKNRVRNMA 279
                            ||              ||.||..      ||:|...|..::::.::   
  Fly   207 ----------------FQ--------------QSWIKEVPTQTCELSLLRANLEFAVRSHLQ--- 238

  Fly   280 PFCRLCMQKLNISPPCRHAKLCILFSGGLDCTILALLANQFVPVNEPIELINVAFESVKGQNISE 344
                           | ..::..|.|||:|.:::|.:|.:.:...:|         :.:.:..|.
  Fly   239 ---------------C-DVQMGALLSGGVDSSLIASIATKIMRERDP---------NFRLKTFSV 278

  Fly   345 KLFDVPD----RKTSLVSVNELKQLCPERCWNLLKVNVTRLELQQHLTSRIKHLIYPLDTVLDES 405
            .|.|.||    |..:....::.|::.              .|:.:.|.. |:.:||.|:|....:
  Fly   279 GLRDAPDFQAARSVAKYIDSDHKEII--------------FEIDEALDG-IRDIIYHLETYDVTT 328

  Fly   406 LGCA---FWFASHCTHSTARVALIGSGADELFGGYTRYRNSYSRCLGNDLERQLAVQNELERDWQ 467
            :.|:   ...|.:...:..::.|.|.||||:||||..:..:.|.   ||...:|.         :
  Fly   329 VRCSLPMLLLARYIKSTGIKMILSGEGADEIFGGYLYFHKAPSY---NDFHEELV---------K 381

  Fly   468 RISARNLA---RDDRIIADTGKTARSPFIEENFVKFIRSL--------------EVYQKCCFGFP 515
            |:...:|:   |.:::....|...|.||::..||..:..:              ||.||..    
  Fly   382 RVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQIRPEDKIPGPLNKFGEVQQKRL---- 442

  Fly   516 EGVGDKLLLRLYGYQIGLRDVVFLKKRAIQFGS-----------RIANKKQNGSHQSD 562
                :|.:||.......|.|.|..:::. ||..           |:|.     ||.||
  Fly   443 ----EKYVLRAAFADNYLPDEVLWRQKE-QFSDGVGYDWIDSIRRVAT-----SHVSD 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17486NP_001036446.2 Gn_AT_II_novel 1..175 CDD:239735 44/213 (21%)
Asn_Synthase_B_C 266..547 CDD:238949 60/304 (20%)
AsnSNP_996132.1 asnB 1..554 CDD:236513 126/643 (20%)
AsnB 2..>182 CDD:238364 41/199 (21%)
Asn_synthase 225..528 CDD:279122 68/335 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0367
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.