DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and STRADA

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001003787.1 Gene:STRADA / 92335 HGNCID:30172 Length:431 Species:Homo sapiens


Alignment Length:375 Identity:120/375 - (32%)
Similarity:187/375 - (49%) Gaps:50/375 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YKLLEILKNGMIGTVYKAEDINNKCLA----------VKKVSMDQ-PMEKLTLLFNEVLTVRRLQ 63
            |:||.::..|.       ||:....||          |::::::. ..|.:|.|..|:...:...
Human    69 YELLTVIGKGF-------EDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFN 126

  Fly    64 HRNINTIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSEHY 128
            |.||....:.|:....:::...||.:|:.:.|:...:..|..|:|||.||:.||.||.|||...|
Human   127 HPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGY 191

  Fly   129 VHGSVRAKHILLS-PRKAVLSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSGY 192
            ||.||:|.|||:| ..|..||......|.||.|:::..:........|.|.|.:||||.|||.||
Human   192 VHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGY 256

  Fly   193 TEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEHTNKRI 257
            ..|.||||:|||.||:|||..||||...|.|.:||:.|::..|||.:::...:.::|   .::.:
Human   257 DAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMS---PSRSV 318

  Fly   258 ARDVI--------------------VNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQC- 301
            |...:                    .:::||.:||.|||.||.:||.:|.:||.|:.|||.||. 
Human   319 ANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIK 383

  Fly   302 -RNTSLLDQLKDLGQKMSKFKRNEHE----IFSDARGSHNPQPNDTIWKF 346
             |.:..|.:|......::.|:.::.:    ||.........:.:|  |:|
Human   384 RRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDD--WEF 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 114/335 (34%)
S_TKc 10..298 CDD:214567 108/319 (34%)
STRADANP_001003787.1 S_TKc 69..379 CDD:214567 108/319 (34%)
PK_STRAD_alpha 70..396 CDD:173767 113/335 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..347 2/39 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3889
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12448
Inparanoid 1 1.050 170 1.000 Inparanoid score I4118
Isobase 1 0.950 - 0 Normalized mean entropy S3215
OMA 1 1.010 - - QHG52849
OrthoDB 1 1.010 - - D421757at33208
OrthoFinder 1 1.000 - - FOG0003031
OrthoInspector 1 1.000 - - otm40274
orthoMCL 1 0.900 - - OOG6_108116
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4773
SonicParanoid 1 1.000 - - X2021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.720

Return to query results.
Submit another query.