DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and KIC1

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_011970.1 Gene:KIC1 / 856502 SGDID:S000001144 Length:1080 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:79/347 - (22%)
Similarity:160/347 - (46%) Gaps:59/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YKLLEILKNGMIGTVYKAEDI-NNKCLAVKKVSMDQPMEKLTLLFNEVLTVRRL-QHRNINTIVS 72
            :|..|::..|..|.|||..:: ..:..|:|.:::|...:::..:..|:..:..| |..||.....
Yeast    23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYG 87

  Fly    73 CFLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSEHYVHGSVRAKH 137
            .:|....:::..:....|:...||:   .....|..|.:|::::|.||..||.::.:|..::|.:
Yeast    88 SYLKDTSLWIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAAN 149

  Fly   138 ILLSPRKAVLSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSGYTEKIDIYSIG 202
            :|::..    .|...|...::....:|.:...|:.  ...||.||||:.:.:. |..|:||:|:|
Yeast   150 VLITNE----GNVKLCDFGVAAQVNQTSLRRQTMA--GTPYWMAPEVIMEGVY-YDTKVDIWSLG 207

  Fly   203 ITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEHTNKRIARDVIVNKSF 267
            ||..|:|.|..|:.|       :|.:|....::..|...||                    ::|:
Yeast   208 ITTYEIATGNPPYCD-------VEALRAMQLIIKSKPPRLE--------------------DRSY 245

  Fly   268 SENFHQFVELCLNKNPLSRWAASKLMTHSFLK--QCRNTSLLDQLKDLGQKMSKF------KRNE 324
            |.:..:|:.|||:::|..|.:|..|:...|::  :...||:|.:|      :|::      .:|:
Yeast   246 STSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKEL------ISRYLLFRDKNKNK 304

  Fly   325 HEIFSD------ARGSHNPQPN 340
            ::|...      ::.|..|:|:
Yeast   305 YKIEGSIPENEPSKPSEAPKPS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 73/305 (24%)
S_TKc 10..298 CDD:214567 68/289 (24%)
KIC1NP_011970.1 STKc_NAK1_like 21..295 CDD:270822 74/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.