DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and ATMAP4K ALPHA1

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001185209.1 Gene:ATMAP4K ALPHA1 / 841750 AraportID:AT1G53165 Length:688 Species:Arabidopsis thaliana


Alignment Length:324 Identity:92/324 - (28%)
Similarity:158/324 - (48%) Gaps:53/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YKLLEILKNGMIGTVYKAEDIN-NKCLAVKKVSMDQPMEKLTLLFNEVLTVRRLQHRNINTIVSC 73
            :...|::..|..|.||||.|.. ||.:|:|.:.:::..:::..:..|:..:.:.:...|......
plant    15 FSQFELIGRGSFGDVYKAFDTELNKDVAIKVIDLEESEDEIEDIQKEISVLSQCRCPYITEYYGS 79

  Fly    74 FLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFP--EVAIALILKDVLSALTYIHSEHYVHGSVRAK 136
            :|::..:::..::|..|:...||:    .|.|  |::||.|.:|:|.|:.|:|:|..:|..::|.
plant    80 YLHQTKLWIIMEYMAGGSVADLLQ----PGNPLDEISIACITRDLLHAVEYLHAEGKIHRDIKAA 140

  Fly   137 HILLSPRKAV-LSNFSY-CQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSGYTEKIDIY 199
            :||||....| :::|.. .|...:...:|||: |:.       :|.||||: ||..||.||.||:
plant   141 NILLSENGDVKVADFGVSAQLTRTISRRKTFV-GTP-------FWMAPEVI-QNSEGYNEKADIW 196

  Fly   200 SIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSL-EHTNKRIARDVIV 263
            |:|||..|||.|..|..|..           .::||.    ::..:....| ||           
plant   197 SLGITMIEMAKGEPPLADLH-----------PMRVLF----IIPRESPPQLDEH----------- 235

  Fly   264 NKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRNT-SLLDQLKDLGQKMSKFKRNEHE 326
               ||....:||..||.|.|..|..|.:|:.|.|:|..|.: .||:::::    ..|::..|.|
plant   236 ---FSRPLKEFVSFCLKKAPAERPNAKELLKHRFIKNARKSPKLLERIRE----RPKYQVKEDE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 89/308 (29%)
S_TKc 10..298 CDD:214567 84/293 (29%)
ATMAP4K ALPHA1NP_001185209.1 STKc_MST3_like 14..287 CDD:270786 90/317 (28%)
S_TKc 19..267 CDD:214567 84/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.