DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and STRADB

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_061041.2 Gene:STRADB / 55437 HGNCID:13205 Length:418 Species:Homo sapiens


Alignment Length:383 Identity:106/383 - (27%)
Similarity:172/383 - (44%) Gaps:50/383 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMCSNNISDYKLLEILKNGM--IGTVYKAEDINNKCLAVKKVSMDQPM--EKLTLLFNEVLTVRR 61
            ::||.|:|.|:|...:..|.  :.:|:.|.......|...|::..:..  |:|..|...|:....
Human    49 VLCSTNVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHF 113

  Fly    62 LQHRNINTIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSE 126
            .:|.||.|..:.|....::::...||.:|:...||:..:..|..|..|..||...:..|.|:|..
Human   114 FRHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQN 178

  Fly   127 HYVHGSVRAKHILLSPRKAV-LSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLS 190
            ..:|.|::|.|||:|....| ||..|:..|.:..|::...::...........|.:||:|.|:|.
Human   179 GCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLH 243

  Fly   191 GYTEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRG------SLQVLLDKNSLLENQGSLS 249
            ||..|.||||:|||.||:|:|..||:|...|.|.::|::|      .:.:.....|.::|    |
Human   244 GYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKN----S 304

  Fly   250 LEHTNKRIARDVIV----------------NKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFL 298
            ....:..|...|:|                :|:||..|...|:|||.::|..|.:||.|::|.|.
Human   305 QSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFF 369

  Fly   299 KQCR---NTSLLDQLKDLGQKMS-------KFKRNEHEIFSDARGSHNPQPNDTIWKF 346
            ||.:   ..|:|..|.....|.|       .:...|.:.         |...|:.|:|
Human   370 KQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDF---------PDEKDSYWEF 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 96/334 (29%)
S_TKc 10..298 CDD:214567 89/314 (28%)
STRADBNP_061041.2 PK_STRAD_beta 59..386 CDD:270864 94/330 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3889
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4118
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52849
OrthoDB 1 1.010 - - D421757at33208
OrthoFinder 1 1.000 - - FOG0003031
OrthoInspector 1 1.000 - - otm40274
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.