DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and Stk39

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_058562.1 Gene:Stk39 / 53416 MGIID:1858416 Length:556 Species:Mus musculus


Alignment Length:367 Identity:93/367 - (25%)
Similarity:167/367 - (45%) Gaps:77/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YKLLEILKNGMIGTVYKAEDINNKC------LAVKKVSMDQPMEKLTLLFNEVLTVRRLQHRNIN 68
            |:|.|::.:|....|..|     .|      :|:|::::::....:..|..|:..:.:..|.|:.
Mouse    75 YELQEVIGSGATAVVQAA-----LCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPNVV 134

  Fly    69 TIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSG------FPEVAIALILKDVLSALTYIHSEH 127
            |..:.|:.|..::|..|.:..|:...::|.:...|      ..|..||.|||:||..|.|:|...
Mouse   135 TYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNG 199

  Fly   128 YVHGSVRAKHILLSPRKAV-LSNFSYCQSFISQG-------EKKTFIFGSTVGIEKELYWTAPEV 184
            .:|..::|.:|||....:| :::|. ..:|::.|       .:|||: |:..       |.||||
Mouse   200 QIHRDLKAGNILLGEDGSVQIADFG-VSAFLATGGDVTRNKVRKTFV-GTPC-------WMAPEV 255

  Fly   185 LYQNLSGYTEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLS 249
            :.| :.||..|.|::|.|||..|:|.|..|:      :.|     ..::||:           |:
Mouse   256 MEQ-VRGYDFKADMWSFGITAIELATGAAPY------HKY-----PPMKVLM-----------LT 297

  Fly   250 LEH---TNKRIARDVIVNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRN-----TSL 306
            |::   |.:....|..:.|.:.::|.:.:.|||.|:|..|..|::|:...|.::.:|     ..|
Mouse   298 LQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKL 362

  Fly   307 LDQLKDLGQKMSKFKRNEHEIFSDARGS----HNPQPNDTIW 344
            |.:..|:.|:..|.:|        ..||    |..:..|..|
Mouse   363 LTRTPDIAQRAKKVRR--------VPGSSGHLHKTEDGDWEW 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 84/329 (26%)
S_TKc 10..298 CDD:214567 80/310 (26%)
Stk39NP_058562.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
STKc_OSR1_SPAK 73..349 CDD:270787 80/310 (26%)
S_TKc 75..349 CDD:214567 80/310 (26%)
Interaction with RELT. /evidence=ECO:0000269|PubMed:16530727 322..547 22/83 (27%)
Nuclear localization signal. /evidence=ECO:0000255 372..378 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..434 7/32 (22%)
Caspase cleavage related site 399..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.