DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and GckIII

DIOPT Version :10

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster


Alignment Length:54 Identity:12/54 - (22%)
Similarity:18/54 - (33%) Gaps:24/54 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EMFSMCEHHLVPF--------YGK----------------VSIGYLPCKKILGL 254
            ||.:..::.:|.|        ||.                :|.|:|....||.|
  Fly    13 EMLTNLDYSIVRFEEEQQPLKYGMEFCPRVPLSQWLAITLISFGFLTIFVILCL 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 12/54 (22%)
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 12/54 (22%)

Return to query results.
Submit another query.