DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and Slik

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster


Alignment Length:352 Identity:88/352 - (25%)
Similarity:155/352 - (44%) Gaps:60/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNI---SD----YKLLEILKNGMIGTVYKAEDINNKCLAVKKVSMDQPMEKLTLLFNEVLTVRRL 62
            |||   :|    ::::..|.:|..|.||||:....|..|..|:...:..|.|:....|:..:..:
  Fly    25 NNIKMDTDPAEFWEMVGELGDGAFGKVYKAQHKEQKRFAAAKMCQLEDEENLSDHMVEIDILSEI 89

  Fly    63 QHRNINTIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSEH 127
            :|.||..:...|.....:::..:: |.|.....:.........|..||.:.|.:...||::|...
  Fly    90 KHPNIVELYEAFSIDDKLWMLIEY-CDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNK 153

  Fly   128 YVHGSVRAKHILLSPRKAV-LSNFSYCQSFISQGEKKTFIFGST-VGIEKELYWTAPE-VLYQNL 189
            .:|..::|.::||:....| |::|.     :|...|.|.....| :|..   ||.||| ||.:..
  Fly   154 VIHRDLKAGNVLLTMEGGVKLADFG-----VSAKNKHTMQKHDTFIGTP---YWMAPELVLCETF 210

  Fly   190 --SGYTEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEH 252
              :.|..|:||:|:|||..|:|....|  ::|::.|         :|||.    ::......||.
  Fly   211 RDNPYDHKVDIWSLGITLIELAQMEPP--NSEMSPM---------RVLLK----IQKSEPPKLEQ 260

  Fly   253 TNKRIARDVIVNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRNTSLLD--QLKDLGQ 315
            .::           :|:.|:.|::..|.|:|..|.....||.|:|:.  ||   ||  .:|||  
  Fly   261 PSR-----------WSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFIN--RN---LDAKPIKDL-- 307

  Fly   316 KMSKFKRNEHEIFSDARGSHNPQPNDT 342
             :.::|.   |:..:.......:|.::
  Fly   308 -LLEYKA---EVVEEVVDDETEEPRNS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 80/318 (25%)
S_TKc 10..298 CDD:214567 73/292 (25%)
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 82/321 (26%)
S_TKc 37..295 CDD:214567 73/292 (25%)
PKK 958..1095 CDD:289257
PKK 1126..1266 CDD:289257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.