DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and Tao

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster


Alignment Length:317 Identity:88/317 - (27%)
Similarity:145/317 - (45%) Gaps:66/317 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLLEILK---NGMIGTVYKAE-DINNKCLAVKKVSM--DQPMEKLTLLFNEVLTVRRLQHRNINT 69
            |:.|.|:   :|..|.||.|. ::..:.:|:||:|.  .|..||...:..|:..:|:|.|.|...
  Fly    25 KIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIE 89

  Fly    70 IVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSEHYVHGSVR 134
            ...|:|.:...:|..:: |.|:...::: |:.....|..||.|...|||.|:|:||...:|..::
  Fly    90 YKGCYLRESTAWLVMEY-CVGSASDIIE-VHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIK 152

  Fly   135 AKHILLSPRKAVLSNFSYCQSFISQGEKKTFIFGST---------VGIEKELYWTAPEVLYQNLS 190
            |.:|||:                ..|..|...|||.         ||..   ||.||||:.....
  Fly   153 AGNILLT----------------DNGVVKLADFGSAAIKCPANSFVGTP---YWMAPEVILAMDE 198

  Fly   191 G-YTEKIDIYSIGITCCEMANGFQP-FKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSLSLEHT 253
            | |..|:|::|:||||.|:|....| |....::.:|               .:.:|:.       
  Fly   199 GQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALY---------------HIAQNES------- 241

  Fly   254 NKRIARDVIVNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRNTSLLDQL 310
                  ..:....:|:.|..||||||.|.|..|.:::||:||:::.:.|:.::|.:|
  Fly   242 ------PTLPKNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLEL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 88/317 (28%)
S_TKc 10..298 CDD:214567 85/303 (28%)
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 85/305 (28%)
S_TKc 27..280 CDD:214567 84/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.