DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and Oxsr1

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001101664.1 Gene:Oxsr1 / 316064 RGDID:1310466 Length:527 Species:Rattus norvegicus


Alignment Length:342 Identity:89/342 - (26%)
Similarity:165/342 - (48%) Gaps:55/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNNISDYKLLEILKNGMIGTVYKAEDINNK-CLAVKKVSMDQPMEKLTLLFNEVLTVRRLQHRNI 67
            |.|..||:|.|::.:|....|..|.....| .:|:|::::::....:..|..|:..:.:..|.||
  Rat    11 SINRDDYELQEVIGSGATAVVQAAYCAPKKERVAIKRINLEKCQTSMDELLKEIQAMSQCHHPNI 75

  Fly    68 NTIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSG------FPEVAIALILKDVLSALTYIHSE 126
            .:..:.|:.|..::|..|.:..|:...::|::...|      ..|..||.||::||..|.|:|..
  Rat    76 VSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKGGVLDESTIATILREVLEGLEYLHKN 140

  Fly   127 HYVHGSVRAKHILLSPRKAV-LSNFSYCQSFISQG-------EKKTFIFGSTVGIEKELYWTAPE 183
            ..:|..|:|.:|||....:| :::|. ..:|::.|       .:|||: |:..       |.|||
  Rat   141 GQIHRDVKAGNILLGEDGSVQIADFG-VSAFLATGGDITRNKVRKTFV-GTPC-------WMAPE 196

  Fly   184 VLYQNLSGYTEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRGSLQVLLDKNSLLENQGSL 248
            |:.| :.||..|.||:|.|||..|:|.|..|:      :.|     ..::||:           |
  Rat   197 VMEQ-VRGYDFKADIWSFGITAIELATGAAPY------HKY-----PPMKVLM-----------L 238

  Fly   249 SLEHTNKRI---ARDVIVNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQCRN-----TS 305
            :|::....:   .:|..:.|.:.::|.:.:.|||.|:|..|..|::|:.|.|.::.:|     ..
  Rat   239 TLQNDPPSLDTGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFLQEK 303

  Fly   306 LLDQLKDLGQKMSKFKR 322
            :|.:...:.::..|.:|
  Rat   304 ILQRAPTISERSKKVRR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 85/327 (26%)
S_TKc 10..298 CDD:214567 81/305 (27%)
Oxsr1NP_001101664.1 STKc_OSR1_SPAK 15..291 CDD:270787 82/307 (27%)
S_TKc 17..291 CDD:214567 81/305 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.