DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stlk and stradb

DIOPT Version :9

Sequence 1:NP_001036442.1 Gene:Stlk / 3355135 FlyBaseID:FBgn0046692 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_002936585.3 Gene:stradb / 100495317 XenbaseID:XB-GENE-988544 Length:419 Species:Xenopus tropicalis


Alignment Length:342 Identity:114/342 - (33%)
Similarity:165/342 - (48%) Gaps:30/342 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MCSNNISDYKLLEILKNGM--IGTVYKAEDINNKCLAVKKVS-MDQ-PMEKLTLLFNEVLTVRRL 62
            :|:..:|.|:|...|..|.  :.|||.|.......|...:|: :|. ..|.|.:|.|||:.....
 Frog    51 VCTCEVSSYELQTELGKGFCNLTTVYLARHTPTGTLVTVRVTDLDNCTDEHLKILQNEVVMSSFF 115

  Fly    63 QHRNINTIVSCFLYKQYVYLTYKFMCFGNCEVLLKNVYTSGFPEVAIALILKDVLSALTYIHSEH 127
            :|.||......|.....:::...||.:|:...||||.|..|..|..|..||...|.||.|:|...
 Frog   116 RHPNIMVSWKIFTTGALLWIVSPFMAYGSASSLLKNYYPDGMNEALIGSILYGALKALHYLHQNS 180

  Fly   128 YVHGSVRAKHILLSPRKAV-LSNFSYCQSFISQGEKKTFIFGSTVGIEKELYWTAPEVLYQNLSG 191
            |:|.:|:|.|||:|....| ||..|:....:..|||....:.........|.|.:||:|.|:|.|
 Frog   181 YIHRNVKASHILISEEGLVTLSGLSHLYCMVKNGEKAKVAYDFPNFSTAMLPWFSPELLRQDLYG 245

  Fly   192 YTEKIDIYSIGITCCEMANGFQPFKDTELTYMYIEKVRG-----------SLQVLLDKNS----- 240
            |..|.||||||||.||:|.|..||.|...|.|.::|::|           |.:....|||     
 Frog   246 YNVKSDIYSIGITACELATGRVPFMDMHRTQMLLQKLKGLPHSPLYSTTFSCESSPIKNSRSGMD 310

  Fly   241 --LLEN--QGSLSLEHTNKRIARDVIVNKSFSENFHQFVELCLNKNPLSRWAASKLMTHSFLKQC 301
              :.|:  ..|::...|::|:...  ..|:||.:....|||||.::|..|.:|..|::|:|.||.
 Frog   311 SGIGESVVAASMTQTMTSERLRTP--SPKTFSSDLQNLVELCLQQDPEKRPSAGNLLSHAFFKQI 373

  Fly   302 R---NTSLLDQLKDLGQ 315
            |   :.|:|..|..|.:
 Frog   374 REQTHGSILSLLPSLAR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StlkNP_001036442.1 PK_STRAD 7..312 CDD:270856 112/332 (34%)
S_TKc 10..298 CDD:214567 104/312 (33%)
stradbXP_002936585.3 PK_STRAD_beta 60..387 CDD:270864 110/328 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3895
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4020
OMA 1 1.010 - - QHG52849
OrthoDB 1 1.010 - - D421757at33208
OrthoFinder 1 1.000 - - FOG0003031
OrthoInspector 1 1.000 - - otm47447
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.