DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and RP1L1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_849188.4 Gene:RP1L1 / 94137 HGNCID:15946 Length:2400 Species:Homo sapiens


Alignment Length:405 Identity:86/405 - (21%)
Similarity:151/405 - (37%) Gaps:108/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 NTPTADHIKKRIPS-SRTPT----RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRL 195
            |.....|.:..:|| :|||:    ..|.:|.|.:.||..:.|:.:.|....:::|..|.::|:  
Human     7 NAQAPSHRECFLPSVARTPSVTKVTPAKKITFLKRGDPRFAGVRLAVHQRAFKTFSALMDELS-- 69

  Fly   196 LEENVKIPGAVRTIYNLCG-KKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSR 259
              :.|.:...||::....| ..:::|::||||..|:||      .|....|.|.|          
Human    70 --QRVPLSFGVRSVTTPRGLHSLSALEQLEDGGCYLCS------DKKPPKTPSGP---------- 116

  Fly   260 SNSHRLAKCRPSSPLKNGL--LAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGT 322
                  .:.:..:|....|  :.|....|    ||.          |.|.::..||.:.||:: .
Human   117 ------GRPQERNPTAQQLRDVEGQREAP----GTS----------SSRKSLKTPRRILLIKN-M 160

  Fly   323 KPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGT 387
            .||....::|:.||:.:....|...:.::|..   |::::|.||..|..|.....|..|....|.
Human   161 DPRLQQTVVLSHRNTRNLAAFLGKASDLLRFP---VKQLYTTSGKKVDSLQALLHSPSVLVCAGH 222

  Fly   388 ERINTAEDFKLEAEEQRAINVIRKTMRTT--GTTCK------GPK---------------PKMPI 429
            |...|.           |:...|::...|  |.|.:      |||               |::|.
Human   223 EAFRTP-----------AMKNARRSEAETLSGLTSRNKNGSWGPKTKPSVIHSRSPPGSTPRLPE 276

  Fly   430 KSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGME----INELPSNIRNTYSLGRIIGDGNFAI 490
            :.....||:..:.....:.||.  :...|:....|:    :||                ||:.::
Human   277 RPGPSNPPVGPAPGRHPQDTPA--QSGPLVAGDDMKKKVRMNE----------------DGSLSV 323

  Fly   491 VFKIKHRQTGHSYAL 505
            ..|::....|....|
Human   324 EMKVRFHLVGEDTLL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 24/95 (25%)
DCX 308..396 CDD:214711 22/87 (25%)
PKc_like 477..734 CDD:304357 5/29 (17%)
S_TKc 477..734 CDD:214567 5/29 (17%)
RP1L1NP_849188.4 DCX 34..111 CDD:176357 22/86 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..152 14/83 (17%)
UBQ 152..226 CDD:320785 20/77 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..310 14/81 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..1064
Herpes_ICP4_C 561..>904 CDD:332854
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1188..1251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1275..1501
3 X 16 AA approximate tandem repeats of T-E-E-G-L-Q-E-E-G-V-Q-L-E-E-T-K 1292..1342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1697..2400
Na_Ca_ex <1697..1935 CDD:332332
Na_Ca_ex <1824..2121 CDD:332332
25 X 16 AA approximate tandem repeats of [ED]-[AT]-[PQ]-[ED]-[AVT]-E-[GKE]-[ED]-[AMT]-Q-[EPK]- [EAT]-[TSELP]-[EG]-[EGSQDI]-[AVIE] 1836..2244
Na_Ca_ex <2020..>2260 CDD:332332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.