DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and STK17A

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_004751.2 Gene:STK17A / 9263 HGNCID:11395 Length:414 Species:Homo sapiens


Alignment Length:294 Identity:88/294 - (29%)
Similarity:154/294 - (52%) Gaps:16/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 PEDDRHAALLTSTGMEINELPSNIRNTYSL--GRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNK 512
            |...:...|||.....:...|  .::.|||  ||.:|.|.||:|.|...:.:|..:|.|.:.|.:
Human    34 PPPPQARGLLTEIRAVVRTEP--FQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRR 96

  Fly   513 CKGKEHYIDA--EVRVMK-KLNHPHIISLILSVDQNTNMYLVLEYVSGGDLFD--AITQVTRFSE 572
             ||::..::.  |:.|:: ..::|.:|:|....:..:.|.|||||.:||::||  ...:...|.|
Human    97 -KGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKE 160

  Fly   573 NQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLA--CEVNDLLYAV 635
            ...:.::|.:...:.:||:..:||.|:||:|:|  |.....:.::|:.||||:  .:.::.|..:
Human   161 KDVQRLMRQILEGVHFLHTRDVVHLDLKPQNIL--LTSESPLGDIKIVDFGLSRILKNSEELREI 223

  Fly   636 CGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPY 700
            .|||.|||||||......:..|:|:.|::.|::|.|..||:..|.|:  .|..|......:.:..
Human   224 MGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQE--TFLNISQMNLSYSEEE 286

  Fly   701 WSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            :..:.:...|.|..:|...|:.|.|:|:.|.|.|
Human   287 FDVLSESAVDFIRTLLVKKPEDRATAEECLKHPW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 82/265 (31%)
S_TKc 477..734 CDD:214567 82/265 (31%)
STK17ANP_004751.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 1/5 (20%)
STKc_DRAK1 51..321 CDD:271099 84/277 (30%)
S_TKc 64..321 CDD:214567 80/262 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.