DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and STK17B

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_004217.1 Gene:STK17B / 9262 HGNCID:11396 Length:372 Species:Homo sapiens


Alignment Length:296 Identity:93/296 - (31%)
Similarity:154/296 - (52%) Gaps:32/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 AALLTSTGMEINELP---SNIRNTYSL-GRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNK---- 512
            :.|||:|    .::|   .|..|.|.| .:.:|.|.||:|.:...:.||..||.|.:.|.:    
Human    12 SGLLTTT----PQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQD 72

  Fly   513 CKGKEHYIDAEVRVMKKLNH-PHIISLILSVDQNTNMYLVLEYVSGGDLFD-AITQVTRF-SENQ 574
            |:.:   |..|:.|::.... |.:|:|....:..:.:.|:|||.:||::|. .:.::... |||.
Human    73 CRAE---ILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSEND 134

  Fly   575 SRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGL------ACEVNDLLY 633
            ...:|:.:...:.|||...|||.|:||:|:|  |.....:.::|:.|||:      |||:.::: 
Human   135 VIRLIKQILEGVYYLHQNNIVHLDLKPQNIL--LSSIYPLGDIKIVDFGMSRKIGHACELREIM- 196

  Fly   634 AVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPD 698
               |||.|:|||||.........|:|..|||.|:||....|||..|||:..|..:.::  .::.:
Human   197 ---GTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVN--VDYSE 256

  Fly   699 PYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            ..:|.:.....|.|.::|..:|:.|.|:|..|.|||
Human   257 ETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 84/270 (31%)
S_TKc 477..734 CDD:214567 84/270 (31%)
STK17BNP_004217.1 STKc_DRAK2 24..293 CDD:271100 88/280 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.