DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and TDA1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_014019.1 Gene:TDA1 / 855336 SGDID:S000004905 Length:586 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:105/400 - (26%)
Similarity:162/400 - (40%) Gaps:132/400 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 MRTTGTTCKGPKPKMPIKSKKVYPPL----VDSEPFKAETTPEDDRHAALLTSTGMEINELPSNI 473
            |.|..::....:.::|  .:|.:|.|    .|::.||.:                        .:
Yeast     1 MTTASSSASQLQQRLP--EEKPWPQLSGSNADAQTFKCK------------------------YV 39

  Fly   474 RNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAE----------VRVMK 528
            .|..||    |||||::|.:..:..|...||:|:|.|...|.|...|..|          :|.|:
Yeast    40 TNHNSL----GDGNFSVVKECMNIHTKDLYAMKLIKKQTVKNKIQLIQREFDLLRSISEKIRDME 100

  Fly   529 KLN---------HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAI---------TQVTRFSENQS 575
            |.|         |.||:.|....:...|:.|:.:....|||::.|         ||||.:     
Yeast   101 KKNEHSLDIFEGHHHILQLFDYFETADNIVLITQLCQKGDLYEKIVENQCLDLETQVTSY----- 160

  Fly   576 RIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKL-----------DEHGN------VLELKLADFG 623
               ...|.:.:.:|||.||||||:|.||:|.:|           :.||:      ..:|.|||||
Yeast   161 ---CACLVSVLEFLHSQGIVHRDLKAENVLFRLRVNENEKNLQGEHHGDFKYDLLAHDLVLADFG 222

  Fly   624 LACEVN----DLLYAVCGTPTYVAPEILL----------EVG----YGLKIDVWAAGIILYILLC 670
            ||.|.|    :.|....||.:|:||||:.          :||    ||..:|:||.|::.|.:..
Yeast   223 LAAEYNTSKVNSLKEFVGTISYIAPEIVKCKGVGEMTPDQVGKLDKYGCPVDIWALGVLTYFMAF 287

  Fly   671 GFPPFVAPDNQQEPLFDAIISGIY-----EFPDP----YWSDIGDGVRDLIANMLQA----DPDV 722
            |:.||....:.:  ..:.|....|     ...||    :|            |.:|.    ||.|
Yeast   288 GYTPFDCTTDDE--TLECISKCDYYVDEQMMHDPKYEQFW------------NFVQCCFTIDPAV 338

  Fly   723 RFTSEDILDH 732
            |.:::::..|
Yeast   339 RRSAKNLKQH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 94/331 (28%)
S_TKc 477..734 CDD:214567 94/331 (28%)
TDA1NP_014019.1 STKc_CAMK 37..350 CDD:270687 95/361 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.