DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and MEK1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:90/286 - (31%)
Similarity:146/286 - (51%) Gaps:40/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 RIIGDGNFA---IVFKIKHRQTG-----HSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHIIS 537
            ||:|:|.|.   |....|.|...     .:||:|||     |.|.:..|.|.|::.:|:||:||.
Yeast   166 RIVGNGTFGHVLITHNSKERDEDVCYHPENYAVKII-----KLKPNKFDKEARILLRLDHPNIIK 225

  Fly   538 LILS-VDQNTNMYLVLEYVSGGDLFDAITQ---VTRFSENQSRIMIRHLGAAMTYLHSMGIVHRD 598
            :..: .|:|.::|:..:.:.|||||..:.:   :|..||.:|.:::..:..|:.|||...|||||
Yeast   226 VYHTFCDRNNHLYIFQDLIPGGDLFSYLAKGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRD 290

  Fly   599 IKPENLLVKLDEHGNVLELKLADFGLACEVN---DLLYAVCGTPTYVAPEI-------------- 646
            :|.:|:|:...|  ....:.|||||:|.::|   :.::.|.|||.|.|||:              
Yeast   291 LKLDNILLCTPE--PCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSR 353

  Fly   647 ---LLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGV 708
               |.:.||..|.|:|:.|:|.:|:|.|..||....:::..:.:|.| |...|....|..:.|..
Yeast   354 AATLEQRGYDSKCDLWSLGVITHIMLTGISPFYGDGSERSIIQNAKI-GKLNFKLKQWDIVSDNA 417

  Fly   709 RDLIANMLQADPDVRFTSEDILDHSW 734
            :..:.::||.|...|..|:..|.|.|
Yeast   418 KSFVKDLLQTDVVKRLNSKQGLKHIW 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 89/284 (31%)
S_TKc 477..734 CDD:214567 89/284 (31%)
MEK1NP_014996.3 FHA 28..122 CDD:238017
STKc_CAMK 160..443 CDD:270687 89/284 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.