DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CAMK1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_005265573.1 Gene:CAMK1 / 8536 HGNCID:1459 Length:413 Species:Homo sapiens


Alignment Length:271 Identity:108/271 - (39%)
Similarity:165/271 - (60%) Gaps:10/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDAEVRVMKKLNHPHII 536
            :||:.|....::|.|.|:.|...:.::|....|:|.|.|...:|||..::.|:.|:.|:.||:|:
Human    15 DIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIV 79

  Fly   537 SLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKP 601
            :|....:...::||:::.||||:|||.|.:...::|..:..:|..:..|:.|||.:||||||:||
Human    80 ALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKP 144

  Fly   602 ENLL-VKLDEHGNVLELKLADFGLACEVND---LLYAVCGTPTYVAPEILLEVGYGLKIDVWAAG 662
            |||| ..|||...::   ::||||: ::.|   :|...||||.|||||:|.:..|...:|.|:.|
Human   145 ENLLYYSLDEDSKIM---ISDFGLS-KMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIG 205

  Fly   663 IILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSE 727
            :|.||||||:|||.  |.....||:.|:...|||..|||.||.|..:|.|.::::.||:.|||.|
Human   206 VIAYILLCGYPPFY--DENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCE 268

  Fly   728 DILDHSWTIGN 738
            ..|.|.|..|:
Human   269 QALQHPWIAGD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 104/260 (40%)
S_TKc 477..734 CDD:214567 104/260 (40%)
CAMK1XP_005265573.1 STKc_CaMKI_alpha 16..278 CDD:271069 107/267 (40%)
S_TKc 20..276 CDD:214567 104/261 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.