DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and RCK1

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_011357.1 Gene:RCK1 / 852719 SGDID:S000003126 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:404 Identity:120/404 - (29%)
Similarity:185/404 - (45%) Gaps:89/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 FAYGTERINTAEDFKLEAEEQRAINVIRKTMRTTGTTCKGPKPKMPIKSKKVYPPLVDSEPFKAE 447
            ||.|..|.:.:.||.:.:.:                            |:|       ||....|
Yeast    47 FASGCRRSSLSVDFNVTSSD----------------------------SEK-------SEQSCLE 76

  Fly   448 TTPEDDRHAALLTSTGMEINE--------------LPSNIR-NTYSLGRIIGDGNFAIVFKIKHR 497
            ...::|.:...:.||.::::|              .|..:. :.|.|...||:|.|:.|||....
Yeast    77 NNSQEDEYFCDIFSTELKLDETSNKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGI 141

  Fly   498 QTGHS--YALKIIDKNK------CKGKEHY-------IDAEVRVMKKL--NHPHIISLILSVDQN 545
            .|...  .|:|.|.|..      .||.:..       :..||.:.|.:  |:||....|...:..
Yeast   142 NTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQESA 206

  Fly   546 TNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLV---- 606
            ...|||.|.|:||::||.|.|:|.|||:.:|.:|..:..|:.::|.|||||||:||||||.    
Yeast   207 NYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIP 271

  Fly   607 ---------KLDEH------GNVLELKLADFGLACEV-NDLLYAVCGTPTYVAPEILLEVGYGLK 655
                     |.||.      |.:..:||.|||||.:: |:.....|||..|||.|:.....|.:|
Yeast   272 FYGLDGDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTPCGTIEYVASEVFTSKRYSMK 336

  Fly   656 IDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADP 720
            :|:|:.|.:|:.||||:|||.  :..::.|...|..|.|||..|:|.:|..|.::.:.::|:.||
Yeast   337 VDMWSIGCVLFTLLCGYPPFY--EKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDP 399

  Fly   721 DVRFTSEDILDHSW 734
            :.|:..:|.|:..|
Yeast   400 NKRYDIDDFLNDPW 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711 4/12 (33%)
PKc_like 477..734 CDD:304357 103/293 (35%)
S_TKc 477..734 CDD:214567 103/293 (35%)
RCK1NP_011357.1 STKc_RCK1-like 119..414 CDD:270998 104/297 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.