DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and Dcx

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_006257444.1 Gene:Dcx / 84394 RGDID:620670 Length:366 Species:Rattus norvegicus


Alignment Length:438 Identity:146/438 - (33%)
Similarity:213/438 - (48%) Gaps:111/438 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ELD----DLRNLHSSSLTNSVVVGKSTGSLNGVYSITSVTS----ETKTLESVVTTNSASGSACL 134
            |||    |.|:..|.::..|        .:||:.|.|....    .|:||::            |
  Rat     2 ELDFGHFDERDKASRNMRGS--------RMNGLPSPTHSAHCSFYRTRTLQA------------L 46

  Fly   135 SNTPTADHIKKRIPSSRTPTRKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEEN 199
            ||                 .:||.:::|||||||::.||...||::|:|||:.|..||||.|.:|
  Rat    47 SN-----------------EKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDN 94

  Fly   200 VKIPGAVRTIYNLCG-KKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQPLSNLPLSNSRSNSH 263
            :.:|..||.||.:.| :||.|:||||:|:|||||.:| .||||||.....|..::   |.:::::
  Rat    95 INLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDN-FFKKVEYTKNVNPNWSV---NVKTSAN 155

  Fly   264 RLAKCRPSSPLKNGLLAGSSPFPACGGGTGNGSPLIASRLSDRVTVVHPRIVTLIRSGTKPRRIM 328
            ..|   |.|      ||.|:                :::..:....|.|::||:||||.|||:.:
  Rat   156 MKA---PQS------LASSN----------------SAQARENKDFVRPKLVTIIRSGVKPRKAV 195

  Fly   329 RLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGIPVVRLSDFFGSDDVFFAYGTERINTA 393
            |:||||:.:.||:.|||.||:.::|:||.|:|::||.|..|..|.||||.||||.|.|.|:...|
  Rat   196 RVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYA 260

  Fly   394 -EDFKLEAEEQRAINVIRKTMRTTG---------TTCKGPKP----KMP-----------IKSKK 433
             :||.|:..|.|.:.  .....|.|         |:.|.|.|    |.|           ..|.:
  Rat   261 QDDFSLDENECRVMK--GNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQ 323

  Fly   434 VYPPLVDSEPFKAETTPEDDR-HAALLTSTGMEINELPSNIRNTYSLG 480
            :..|.....|....|:|...| |...|        .||.::.::.|||
  Rat   324 LSTPKSKQSPISTPTSPGSLRKHKVDL--------YLPLSLDDSDSLG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711 49/91 (54%)
DCX 308..396 CDD:214711 45/88 (51%)
PKc_like 477..734 CDD:304357 3/4 (75%)
S_TKc 477..734 CDD:214567 3/4 (75%)
DcxXP_006257444.1 DCX1_DCX 51..139 CDD:340529 49/88 (56%)
DCX2 176..259 CDD:340589 44/82 (54%)
KLF8_12_N <284..>343 CDD:424081 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9497
eggNOG 1 0.900 - - E1_KOG3757
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291886at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45843
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.