DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK19

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_176386.2 Gene:CPK19 / 842490 AraportID:AT1G61950 Length:551 Species:Arabidopsis thaliana


Alignment Length:374 Identity:115/374 - (30%)
Similarity:187/374 - (50%) Gaps:50/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 INVIRKTMRTTGTTCKGPKPKM------PIKSKKVYPP--------------LVDSEPFKAE-TT 449
            ||:.:|.        |.|.|.:      .:||:::.|.              .:..:|.|.. ..
plant     6 INLKKKV--------KKPTPDISGEQNTEVKSREITPKEQPRQRQPAPRAKFQIVVQPHKLPLPL 62

  Fly   450 PEDDRHAALLTSTGMEINELP--------SNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALK 506
            |:......|:........:.|        .:|:..|||||.:|.|.|.|.:......:|.::|.|
plant    63 PQPQEKQKLINHQKQSTLQQPEPILGRPFEDIKEKYSLGRELGRGQFGITYICTEISSGKNFACK 127

  Fly   507 IIDKNK---CKGKEHYIDAEVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQV 567
            .|.|.|   .|.:|. :..|:::|..|: .|:|:.:..:.:...:::||:|...||:|||.||:.
plant   128 SILKRKLIRTKDRED-VRREIQIMHYLSGQPNIVEIKGAYEDRQSVHLVMELCEGGELFDKITKR 191

  Fly   568 TRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLA--CEVND 630
            ..:||..:..:||.:...:...|.||::|||:||||.|:...:..:.: ||..|||::  .|...
plant   192 GHYSEKAAAEIIRSVVKVVQICHFMGVIHRDLKPENFLLSSKDEASSM-LKATDFGVSVFIEEGK 255

  Fly   631 LLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYE 695
            :...:.|:..|||||: |:..||..||:|:||:||||||||.|||.|  ...:.:|:.|:.|..:
plant   256 VYEDIVGSAYYVAPEV-LKRNYGKAIDIWSAGVILYILLCGNPPFWA--ETDKGIFEEILRGEID 317

  Fly   696 FPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGNKGNECT 744
            |....|..|.:..:||:.|||:.||..|||:..:|:|.|.  .:|.|.:
plant   318 FESEPWPSISESAKDLVRNMLKYDPKKRFTAAQVLEHPWI--REGGEAS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 97/262 (37%)
S_TKc 477..734 CDD:214567 97/262 (37%)
CPK19NP_176386.2 STKc_CAMK 97..356 CDD:270687 97/263 (37%)
Pkinase 98..357 CDD:278497 97/263 (37%)
PTZ00184 393..538 CDD:185504
EFh 405..464 CDD:238008
EFh 477..537 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.