DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and AT1G49580

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_175381.1 Gene:AT1G49580 / 841382 AraportID:AT1G49580 Length:606 Species:Arabidopsis thaliana


Alignment Length:385 Identity:104/385 - (27%)
Similarity:161/385 - (41%) Gaps:80/385 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 PKMPIKSKKVYPPLVDSEPFKAETTPEDDRH-------------AALLTSTGME----------- 465
            |..|.||....|....:.||....||...||             :..||||.:.           
plant    32 PDHPGKSPIPTPSAAKASPFFPFYTPSPARHRRNKSRDVGGGGESKSLTSTPLRQLRRAFHPPSP 96

  Fly   466 -------------------------INELP-----------------SNIRNTYSLGRIIGDGNF 488
                                     ..|:|                 ....:...||..||.|:|
plant    97 AKHIRAALRRRKGKKEAALSGVTQLTTEVPQREEEEEVGLDKRFGFSKEFHSRVELGEEIGRGHF 161

  Fly   489 AIVFKIKHRQ---TGHSYALKIIDKNKCKGKEHYIDA--EVRVMKKLN-HPHIISLILSVDQNTN 547
            ......|.::   .|...|:|||.|:|........|.  ||::::.|: |.:::....:.:.|.|
plant   162 GYTCSAKFKKGELKGQVVAVKIIPKSKMTTAIAIEDVRREVKILQALSGHKNLVQFYDAFEDNAN 226

  Fly   548 MYLVLEYVSGGDLFDAI-TQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEH 611
            :|:.:|...||:|.|.| .:..::|||.::.:|..:...:.:.|..|:||||:||||.|....|.
plant   227 VYIAMELCEGGELLDRILARGGKYSENDAKPVIIQILNVVAFCHFQGVVHRDLKPENFLYTSKEE 291

  Fly   612 GNVLELKLADFGLACEV--NDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPP 674
            .:  :||..||||:..|  ::.|..:.|:..|||||: |...|..:.|||:.|:|.||||||..|
plant   292 NS--QLKAIDFGLSDFVRPDERLNDIVGSAYYVAPEV-LHRSYTTEADVWSIGVIAYILLCGSRP 353

  Fly   675 FVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            |.|  ..:..:|.|::.....|.:|.|..:....:|.:..:|..||..|.::...|.|.|
plant   354 FWA--RTESGIFRAVLKADPSFDEPPWPFLSSDAKDFVKRLLFKDPRRRMSASQALMHPW 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 86/265 (32%)
S_TKc 477..734 CDD:214567 86/265 (32%)
AT1G49580NP_175381.1 S_TKc 151..412 CDD:214567 87/266 (33%)
STKc_CAMK 151..411 CDD:270687 86/264 (33%)
FRQ1 452..592 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.