DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CDPK19

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_197446.1 Gene:CDPK19 / 832065 AraportID:AT5G19450 Length:533 Species:Arabidopsis thaliana


Alignment Length:327 Identity:106/327 - (32%)
Similarity:170/327 - (51%) Gaps:23/327 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 GTTCKGPKPKMPIKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPS----NIRNTY 477
            |..|..|..:...|..|   |.:.|.||.:|....:.      :.||.:::.|..    :|...|
plant     2 GNCCASPGSETGSKKGK---PKIKSNPFYSEAYTTNG------SGTGFKLSVLKDPTGHDISLMY 57

  Fly   478 SLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDA--EVRVMKKL-NHPHIISLI 539
            .|||.:|.|.|.|.:.....:||..||.|.|.|.|.:......|.  ||.:||.: .||:|:||.
plant    58 DLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMPRHPNIVSLK 122

  Fly   540 LSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENL 604
            .:.:.:..:::|:|...||:|||.|.....::|..:..:::.:...:...|..|::|||:||||.
plant   123 DAFEDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTILEVVQICHKHGVMHRDLKPENF 187

  Fly   605 LVKLDEHGNVLELKLADFGLAC--EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYI 667
            |....:..:.  ||..||||:.  :..:....:.|:|.|:|||:|.. .||.::|:|:||:||||
plant   188 LFANKKETSA--LKAIDFGLSVFFKPGEGFNEIVGSPYYMAPEVLRR-NYGPEVDIWSAGVILYI 249

  Fly   668 LLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDH 732
            ||||.|||.|  ..::.:..|||..:.:|....|..:.:..:||:..||:.||..|.::..:|:|
plant   250 LLCGVPPFWA--ETEQGVAQAIIRSVIDFKRDPWPRVSETAKDLVRKMLEPDPKKRLSAAQVLEH 312

  Fly   733 SW 734
            ||
plant   313 SW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 90/261 (34%)
S_TKc 477..734 CDD:214567 90/261 (34%)
CDPK19NP_197446.1 STKc_CAMK 57..314 CDD:270687 90/261 (34%)
FRQ1 354..501 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.