DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK7

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_568281.1 Gene:CPK7 / 831123 AraportID:AT5G12480 Length:535 Species:Arabidopsis thaliana


Alignment Length:333 Identity:110/333 - (33%)
Similarity:171/333 - (51%) Gaps:28/333 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 CKGPKPKMPIKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPS----NIRNTYSLG 480
            |.| .|.......|...|...:.||.:......||..|     |.:::.|..    :|...|.||
plant     4 CCG-NPSSATNQSKQGKPKNKNNPFYSNEYATTDRSGA-----GFKLSVLKDPTGHDISLQYDLG 62

  Fly   481 RIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDA--EVRVMKKL-NHPHIISLILSV 542
            |.:|.|.|.|.:....::||..||.|.|.|.|.:......|.  ||.:||.: .||:::||..|.
plant    63 REVGRGEFGITYLCTDKETGEKYACKSISKKKLRTAVDIEDVRREVEIMKHMPKHPNVVSLKDSF 127

  Fly   543 DQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVK 607
            :.:..:::|:|...||:|||.|.....::|..:..:::.:...:...|..|::|||:||||.|..
plant   128 EDDDAVHIVMELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICHKQGVMHRDLKPENFLFA 192

  Fly   608 LDEHGNVLELKLADFGLAC------EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILY 666
            ..:..:.  ||..||||:.      :.|:::    |:|.|:|||:|.. .||.:||||:||:|||
plant   193 NKKETSA--LKAIDFGLSVFFKPGEQFNEIV----GSPYYMAPEVLRR-NYGPEIDVWSAGVILY 250

  Fly   667 ILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILD 731
            |||||.|||.|  ..::.:..|||..:.:|....|..:.|..:||:..||:.||..|.|:..:|:
plant   251 ILLCGVPPFWA--ETEQGVAQAIIRSVIDFKRDPWPRVSDSAKDLVRKMLEPDPKKRLTAAQVLE 313

  Fly   732 HSWTIGNK 739
            |:|.:..|
plant   314 HTWILNAK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 95/265 (36%)
S_TKc 477..734 CDD:214567 95/265 (36%)
CPK7NP_568281.1 STKc_CAMK 58..316 CDD:270687 95/266 (36%)
FRQ1 356..503 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.