DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK15

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:375 Identity:115/375 - (30%)
Similarity:189/375 - (50%) Gaps:34/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 YGTERINTAEDFKLEAEEQRAI-------NVIRKTMRTTGTTCKGPKPKMPIKSKKVYPPLVDSE 442
            :.::..||..|. :....|.:|       :|.|..::..    |.|.|::|..::..:....:|:
plant     4 FSSKHRNTESDI-INGSVQSSIPTNQPENHVSRDVLKPQ----KPPSPQIPTTTQSNHHHQQESK 63

  Fly   443 PFKAETTPEDDRHA-------ALLTSTGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTG 500
            |...:.   :.:|.       .:...|...:.:....||..|:||:.:|.|.|.|.:..|...||
plant    64 PVNQQI---EKKHVLTQPLKPIVFRETETILGKPFEEIRKLYTLGKELGRGQFGITYTCKENSTG 125

  Fly   501 HSYALKIIDKNKCKGKEHYIDA--EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFD 562
            ::||.|.|.|.|...|:...|.  |:::|:.|: ..:|:.:..:.:...:::||:|...|.:|||
plant   126 NTYACKSILKRKLTRKQDIDDVKREIQIMQYLSGQENIVEIKGAYEDRQSIHLVMELCGGSELFD 190

  Fly   563 AITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPEN-LLVKLDEHGNVLELKLADFGLA- 625
            .|.....:||..:..:||.:...:...|.||::|||:|||| ||...||:.   .||..||||: 
plant   191 RIIAQGHYSEKAAAGVIRSVLNVVQICHFMGVIHRDLKPENFLLASTDENA---MLKATDFGLSV 252

  Fly   626 -CEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAI 689
             .|...:...:.|:..|||||:|.. .||.:||:|:|||||||||||.|||.:  ..::.:|:.|
plant   253 FIEEGKVYRDIVGSAYYVAPEVLRR-SYGKEIDIWSAGIILYILLCGVPPFWS--ETEKGIFNEI 314

  Fly   690 ISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGNK 739
            |.|..:|....|..|.:..:||:..:|..||..|.::...|:|.|..|.:
plant   315 IKGEIDFDSQPWPSISESAKDLVRKLLTKDPKQRISAAQALEHPWIRGGE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711 2/10 (20%)
PKc_like 477..734 CDD:304357 96/262 (37%)
S_TKc 477..734 CDD:214567 96/262 (37%)
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 96/263 (37%)
STKc_CAMK 102..359 CDD:270687 96/262 (37%)
PTZ00184 395..540 CDD:185504
EFh 407..466 CDD:238008
EFh 478..539 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.