DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK23

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001190672.1 Gene:CPK23 / 825809 AraportID:AT4G04740 Length:533 Species:Arabidopsis thaliana


Alignment Length:326 Identity:113/326 - (34%)
Similarity:169/326 - (51%) Gaps:40/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 PKPKMPIKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGN 487
            |.|.:||..:.  |..:..:||:                          :||..|||||.:|.|.
plant    43 PSPSIPISVRD--PETILGKPFE--------------------------DIRKFYSLGRELGRGG 79

  Fly   488 FAIVFKIKHRQTGHSYALKIIDKNKC---KGKEHYIDAEVRVMKKLN-HPHIISLILSVDQNTNM 548
            ..|.:..|...||:.||.|.|.|.|.   .|:|. :..|:::|:.|: .|:::.:..|.:...::
plant    80 LGITYMCKEIGTGNIYACKSILKRKLISELGRED-VKTEIQIMQHLSGQPNVVEIKGSYEDRHSV 143

  Fly   549 YLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGN 613
            :||:|..:||:|||.|.....:||..:...|:.:...:...|..|::|||:||||.|....|...
plant   144 HLVMELCAGGELFDRIIAQGHYSERAAAGTIKSIVDVVQICHLNGVIHRDLKPENFLFSSKEENA 208

  Fly   614 VLELKLADFGLAC--EVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFV 676
            :  ||:.||||:.  |...:...|.|:|.|||||:|.: .||.:||:|:||:||||||||.|||.
plant   209 M--LKVTDFGLSAFIEEGKIYKDVVGSPYYVAPEVLRQ-SYGKEIDIWSAGVILYILLCGVPPFW 270

  Fly   677 APDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGNKGN 741
            | || :|.:|..|:....:|....|..|.|..:||:..||..||..|.|:..:|:|.|..|.:..
plant   271 A-DN-EEGVFVEILKCKIDFVREPWPSISDSAKDLVEKMLTEDPKRRITAAQVLEHPWIKGGEAP 333

  Fly   742 E 742
            |
plant   334 E 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 101/262 (39%)
S_TKc 477..734 CDD:214567 101/262 (39%)
CPK23NP_001190672.1 STKc_CAMK 82..326 CDD:270687 94/249 (38%)
S_TKc 84..327 CDD:214567 93/248 (38%)
EF-hand_7 374..433 CDD:290234
EFh 374..433 CDD:238008
EFh 445..>492 CDD:238008
EF-hand_7 446..>492 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.