DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK21

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_001319867.1 Gene:CPK21 / 825807 AraportID:AT4G04720 Length:531 Species:Arabidopsis thaliana


Alignment Length:324 Identity:112/324 - (34%)
Similarity:169/324 - (52%) Gaps:21/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 KPKMPIKSKKVYPPLVDSEPFKAETTPEDDRHAALLTSTGMEINELPSNIRNTYSLGRIIGDGNF 488
            ||:.|.......|  :..:.....:.|...|....:.....|      :||..||||:.:|.|.|
plant    35 KPQTPTPKPMTQP--IHQQISTPSSNPVSVRDPDTILGKPFE------DIRKFYSLGKELGRGQF 91

  Fly   489 AIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDA--EVRVMKKLN-HPHIISLILSVDQNTNMYL 550
            .|.:..|...||::||.|.|.|.|...|:...|.  |:::|:.|: .|:|:.:..:.:...:::|
plant    92 GITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQYLSGQPNIVEIKGAYEDRQSIHL 156

  Fly   551 VLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVL 615
            |:|..:||:|||.|.....:||..:..:||.:...:...|.||:||||:||||.|:...|...: 
plant   157 VMELCAGGELFDRIIAQGHYSERAAAGIIRSIVNVVQICHFMGVVHRDLKPENFLLSSKEENAM- 220

  Fly   616 ELKLADFGLA--CEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAP 678
             ||..||||:  .|...:...:.|:..|||||:|.. .||.:||:|:||:||||||.|.|||.| 
plant   221 -LKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVLRR-SYGKEIDIWSAGVILYILLSGVPPFWA- 282

  Fly   679 DNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSWTIGNKGNE 742
             ..::.:||.:|.|..:|....|..|.:..:||:..||..||..|.|:..:|:|.|.   ||.|
plant   283 -ENEKGIFDEVIKGEIDFVSEPWPSISESAKDLVRKMLTKDPKRRITAAQVLEHPWI---KGGE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 99/261 (38%)
S_TKc 477..734 CDD:214567 99/261 (38%)
CPK21NP_001319867.1 STKc_CAMK 79..337 CDD:270687 99/262 (38%)
PTZ00184 373..518 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.