DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK31

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_680596.2 Gene:CPK31 / 825804 AraportID:AT4G04695 Length:484 Species:Arabidopsis thaliana


Alignment Length:273 Identity:93/273 - (34%)
Similarity:146/273 - (53%) Gaps:16/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 NIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGK--EHYIDAEVRVMKKLN-HP 533
            :|...|.||..:|.|.|.|..|...:.:|.:||.|.|.|...|.:  |..:..|:|:||.|: .|
plant    23 DIGKVYILGDELGQGQFGITRKCVEKTSGKTYACKTILKTNLKSREDEEAVKREIRIMKHLSGEP 87

  Fly   534 HIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTR----FSENQSRIMIRHLGAAMTYLHSMGI 594
            :|:....:.:...::::|:||..||:||..|..:::    :||.::..:||.:...:...|.||:
plant    88 NIVEFKKAYEDRDSVHIVMEYCGGGELFKKIEALSKDGKSYSEKEAVEIIRPIVNVVKNCHYMGV 152

  Fly   595 VHRDIKPEN-LLVKLDEHGNVLELKLADFGLA--CEVNDLLYAVCGTPTYVAPEILLEVGYGLKI 656
            :.||:|||| ||...|::..|   |..|||.:  .|..::.....|:..|:|||: |:..||.:.
plant   153 MLRDLKPENFLLSSTDKNATV---KAIDFGCSVFIEEGEVHRKFAGSAYYIAPEV-LQGKYGKEA 213

  Fly   657 DVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIANMLQADPD 721
            |:|:|||||||||||.||||.....|  :|..|.|...:.....|..|....:.|:..||..:|.
plant   214 DIWSAGIILYILLCGKPPFVTEPEAQ--MFSEIKSAKIDVDSESWKFIDVKAKHLVNRMLNRNPK 276

  Fly   722 VRFTSEDILDHSW 734
            .|.::.::|.|.|
plant   277 ERISAAEVLGHPW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 91/266 (34%)
S_TKc 477..734 CDD:214567 91/266 (34%)
CPK31NP_680596.2 STKc_CAMK 27..289 CDD:270687 91/267 (34%)
S_TKc 28..290 CDD:214567 92/268 (34%)
PTZ00184 325..470 CDD:185504
EFh 337..396 CDD:238008
EFh 412..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.