DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK32

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_191312.2 Gene:CPK32 / 824920 AraportID:AT3G57530 Length:538 Species:Arabidopsis thaliana


Alignment Length:281 Identity:95/281 - (33%)
Similarity:151/281 - (53%) Gaps:23/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 TGMEINELPSNIRNTYSLGRIIGDGNFAIVFKIKHRQTGHSYALKIIDKNKCKGKEHYIDA--EV 524
            ||.|       |.:.|:|||.:|.|.|.:.:....::|...:|.|.|.|.|.:......|.  ||
plant    55 TGRE-------IESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRREV 112

  Fly   525 RVMKKL-NHPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRHLGAAMTY 588
            .:|:.: .||::::|..:.:....::||:|...||:|||.|.....::|..:..:.:.:...:..
plant   113 EIMRHMPEHPNVVTLKETYEDEHAVHLVMELCEGGELFDRIVARGHYTERAAAAVTKTIMEVVQV 177

  Fly   589 LHSMGIVHRDIKPENLLVKLDEHGNVLE---LKLADFGLAC--EVNDLLYAVCGTPTYVAPEILL 648
            .|..|::|||:||||.|     .||..|   ||..||||:.  :..:....:.|:|.|:|||: |
plant   178 CHKHGVMHRDLKPENFL-----FGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEV-L 236

  Fly   649 EVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDAIISGIYEFPDPYWSDIGDGVRDLIA 713
            :..||.::|:|:||:||||||||.|||.|  ..::.:..|||..:.:|....|..:.:..:|||.
plant   237 KRNYGPEVDIWSAGVILYILLCGVPPFWA--ETEQGVAQAIIRSVLDFRRDPWPKVSENAKDLIR 299

  Fly   714 NMLQADPDVRFTSEDILDHSW 734
            .||..|...|.|::.:|||.|
plant   300 KMLDPDQKRRLTAQQVLDHPW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 90/264 (34%)
S_TKc 477..734 CDD:214567 90/264 (34%)
CPK32NP_191312.2 STKc_CAMK 62..320 CDD:270687 90/265 (34%)
FRQ1 360..501 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.