DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CPK9

DIOPT Version :10

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_188676.1 Gene:CPK9 / 821586 AraportID:AT3G20410 Length:541 Species:Arabidopsis thaliana


Alignment Length:177 Identity:33/177 - (18%)
Similarity:55/177 - (31%) Gaps:54/177 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1495 QVAQHLAEQSKDSKEQASSLPSHNHH--------------HGSDKLTGSAMG------------T 1533
            ::.:.:.|:.|..:|:     .|..:              ..:|:|.|....            |
plant    44 EIKRKIKEEQKKMREE-----RHKEYMKMLKEREEALCELEETDELEGLVTSKCESVQYDHPNHT 103

  Fly  1534 TTTTAASSSSASSGG----GGGVVEKENSNALAASSESNGSTA--------------VAASTATT 1580
            .|.|..|....|..|    |....|:|..|...|..|...|:.              :.:.||:.
plant   104 VTVTTISDLDLSGIGLLPLGKAQQEEEEENEKDADEEQPKSSVSLPKKAGDPFLSKKICSLTASL 168

  Fly  1581 GATVAHGTAGGSAAAGNGNNNNNTG----GFIGVSSKRKDSGSGGRS 1623
            .|. :...||...:..|......:|    |....:.:||.:|..||:
plant   169 HAR-SQRKAGKRPSRTNDKKKQTSGKQVSGRTSKAQRRKQTGKIGRN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX1 156..239 CDD:340526
Ubl1_cv_Nsp3_N-like 309..392 CDD:475130
Protein Kinases, catalytic domain 477..734 CDD:473864
CPK9NP_188676.1 STKc_CAMK 90..348 CDD:270687 26/126 (21%)
PTZ00184 385..530 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.