DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17528 and CRK3

DIOPT Version :9

Sequence 1:NP_001036462.1 Gene:CG17528 / 3355134 FlyBaseID:FBgn0261387 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_182193.1 Gene:CRK3 / 819282 AraportID:AT2G46700 Length:595 Species:Arabidopsis thaliana


Alignment Length:371 Identity:100/371 - (26%)
Similarity:160/371 - (43%) Gaps:61/371 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 RTTGTTCKGPKP---KMPIKSKKVYPPLVDSEPFKAET----------TPEDDRH--AALLTSTG 463
            :.|......|.|   ..|..|....|..|...|.:..|          .|...:|  |:|:...|
plant    45 KNTPARSSNPSPWPSPFPHGSASPLPSGVSPSPARTSTPRRFFRRPFPPPSPAKHIKASLIKRLG 109

  Fly   464 MEINELP--------------------SNIRNTYSLGRIIGDGNFAIVFKIKHRQTG-------- 500
            ::..|.|                    .|....|.||:.:|.|:|.      |..:|        
plant   110 VKPKEGPIPEERGTEPEQSLDKSFGYGKNFGAKYELGKEVGRGHFG------HTCSGRGKKGDIK 168

  Fly   501 -HSYALKIIDKNKCKGKEHYIDA--EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLF 561
             |..|:|||.|.|........|.  ||:::|.|: |.::|....:.:...|:|:|:|...||:|.
plant   169 DHPIAVKIISKAKMTTAIAIEDVRREVKLLKSLSGHKYLIKYYDACEDANNVYIVMELCDGGELL 233

  Fly   562 DAI-TQVTRFSENQSRIMIRHLGAAMTYLHSMGIVHRDIKPENLLVKLDEHGNVLELKLADFGLA 625
            |.| .:..::.|:.::.::..:...:::.|..|:||||:||||.|.......:  :|||.||||:
plant   234 DRILARGGKYPEDDAKAIVVQILTVVSFCHLQGVVHRDLKPENFLFTSSREDS--DLKLIDFGLS 296

  Fly   626 --CEVNDLLYAVCGTPTYVAPEILLEVGYGLKIDVWAAGIILYILLCGFPPFVAPDNQQEPLFDA 688
              ...::.|..:.|:..|||||: |...|.|:.|:|:.|:|.||||||..||.|  ..:..:|..
plant   297 DFIRPDERLNDIVGSAYYVAPEV-LHRSYSLEADIWSIGVITYILLCGSRPFWA--RTESGIFRT 358

  Fly   689 IISGIYEFPDPYWSDIGDGVRDLIANMLQADPDVRFTSEDILDHSW 734
            ::.....:.|..|.......:|.:..:|..|...|.::...|.|.|
plant   359 VLRTEPNYDDVPWPSCSSEGKDFVKRLLNKDYRKRMSAVQALTHPW 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17528NP_001036462.1 DCX 153..244 CDD:214711
DCX 308..396 CDD:214711
PKc_like 477..734 CDD:304357 82/271 (30%)
S_TKc 477..734 CDD:214567 82/271 (30%)
CRK3NP_182193.1 STKc_CAMK 142..404 CDD:270687 82/272 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.